High-quality products
Customized solutions
Personal contact
Fast service
Competent technical support +49(0)731-3608-123

human LL-37 - scrambled - GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR

Advantages at a glance

  • High-quality products
  • Customized solutions
  • Personal contact
  • Fast service
  • Competent technical support +49(0)731-3608-123

Quantity Unit price
To 2
€699.00*
From 3
€594.15*
€699.00* (15% saved)
Purity
Weight
Product number: P2955.9505
Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.

Shipment: not cooled. Store at -20°C. For laboratory usage only!
Product information "human LL-37 - scrambled - GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR"

LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is the scrambled version of human LL-37, the only cathelicidin-type peptide found in human.

"Scrambled human LL-37" is a peptide with the identical amino acid composition as human LL-37, but with a "randomized" sequence. Scrambled LL-37 can be used as a negative control peptide. The term "scrambled peptide is a synonym for "homologous negative control peptide".

Amino acid sequence of the scrambled LL-37 peptide: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Amino acid sequence of the "normal" LL-37 peptide: [LL-37, 37 aa]

More information about LL-37 >

Specifications:
Purity: >95% (HPLC)
Sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
C205H341N61O52
MW = 4493.3 g/mol
Lyophilized white powder


Applikation / Application:
Scrambled LL-37 is used as negative control for LL-37 studies.

Einheiten / Units:
Quelle / Source:
synthetic


Sicherheits Hinweise / Safety


Klassifizierungen / Classification

eclass-Nr: 32-16-04-09
Documents - Protocols - Downloads :
Here you will find information and further literature. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.


Documents:

General Data 1
Listed below are articles and references, in which the authors trust in the high quality of this Genaxxon product.
Source: NCBI PubMed