human LL-37 - scrambled - GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Advantages at a glance
- High-quality products
- Customized solutions
- Personal contact
- Fast service
- Competent technical support +49(0)731-3608-123
Quantity | Unit price |
---|---|
To 2 |
€699.00*
|
From 3 |
€594.15*
€699.00*
(15% saved)
|
Product number:
P2955.9505
Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.
Shipment: not cooled. Store at -20°C. For laboratory usage only!
Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.
Shipment: not cooled. Store at -20°C. For laboratory usage only!
Product information "human LL-37 - scrambled - GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR"
LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is the scrambled version of human LL-37, the only cathelicidin-type peptide found in human.
"Scrambled human LL-37" is a peptide with the identical amino acid composition as human LL-37, but with a "randomized" sequence. Scrambled LL-37 can be used as a negative control peptide. The term "scrambled peptide is a synonym for "homologous negative control peptide".
Amino acid sequence of the scrambled LL-37 peptide: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Amino acid sequence of the "normal" LL-37 peptide: [LL-37, 37 aa]
More information about LL-37 >
Specifications:
Purity: >95% (HPLC)
Sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
C205H341N61O52
MW = 4493.3 g/mol
Lyophilized white powder
Applikation / Application:
Scrambled LL-37 is used as negative control for LL-37 studies.
Einheiten / Units:
Quelle / Source:
synthetic
Sicherheits Hinweise / Safety
Klassifizierungen / Classification
eclass-Nr: 32-16-04-09
Documents - Protocols - Downloads :
Here you will find information and further literature. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.
Documents:
General Data 1
Listed below are articles and references, in which the authors trust in the high quality of this Genaxxon product.
Source: NCBI PubMed
Source: NCBI PubMed