rec. Human Interleukin-10 (rHuIL-10)
Order number: C6077.0002
Shipping: shipped at RT, stored at -20°C Ready to ship today,
Delivery time 1-3 workdays
*Prices plus VAT plus shipping costs
IL10 is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Interleukin-10 is fully biologically active when compared to standard. The ED50 as determined by the dose-dependent co-stimulation (with murine IL-4) of MC/9 cells was found to be less than 2.0ng/mL, corresponding to a specific activity of 5.0×105 IU/mg. Amino acid composition: MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN.
Technical Data:
Purity: >97.0% (by RP-HPLC, IEX-HPLC, SDS-PAGE). Less than 1% dimers and aggregates. Sterile Filtered White lyophilized (freeze-dried) powder. The ED50 as determined by the dose-dependent co-stimulation (with murine IL-4) of MC/9 cells was found to
Source
CHO-cellsSicherheits Hinweise / Safety
Klassifizierungen / Classification
eclass-Nr: 32-16-04-90Dokumente - Protokolle - Downloads
Here you will find information and further literature on rec. Human Interleukin-10 (rHuIL-10). For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.