rmLIF - rec. Leukemia Inhibitory Factor

Order number: C6516.0006
Shipping: shipped at RT, stored at -20°C Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.
*Prices plus VAT plus shipping costs
Leukemia Inhibitory Factor (LIF) is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone and fat metabolism, mitogenesis of factor dependent cell lines and promotion of megakaryocyte productin on vivo. Human and mouse LIF show 78% identiy in the amino acid sequence. Human LIF is as active on human cells as it is on mouse cells, though mouse LIF is about 1000 fold less active on human cell, than human LIF.
Rec. Murine Leukemia Inhibitory Factor produced in E.Coli is a single, non-glycosylated, polypeptide of 181 amino acids with a molecular mass of 20kDa.
Leukemia Inhibitory Factor is supplied as a sterile filtered white lyophilized (freeze-dried) powder. It was lyophilized from a concentrated (1mg/mL) sterile solution containing 20mM Phosphate buffer pH7.4 and 0.02% Tween-20.
The amino acid sequence is: MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF.
Biological activity: Activity of murine LIF was determined by the M1 cell differentiation assay which was found to be <0.01ng/mL, corresponding to a specific activity of 100,000,000 IU/mg. A standard of 50 Units is defined as the concentration of mouse LIF in 1.0mL of tissue culture medium that induces the differentiation of 50% of M1 colonies.
Synonmys: CDF, HILDA, D-FACTOR, Differentiation- stimulating factor, Melanoma-derived LPL inhibitor, MLPLI, Emfilermin, Leukemia inhibitory factor, LIF, DIA.
Patent Rights: The sale and/or commercial use of rec. Mouse LIF is prohibited in the United Sates of America (U.S.A.).
Technical Data:
Specifications:
Purity: min. 95% (HPLC)
Specific activity: 100MIU/mg
Source
Escherichia Coli.Sicherheits Hinweise / Safety
Klassifizierungen / Classification
eclass-Nr: 32-16-04-90Dokumente - Protokolle - Downloads
Here you will find information and further literature on rmLIF - rec. Leukemia Inhibitory Factor. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.
Referenzen..
Hier finden Sie Artikel und Literaturzitate, in denen die Autoren auf die hohe Qualität dieses Genaxxonprodukts vertrauen.
Listed below are articles and references, in which the authors trust in the high quality of this Genaxxon product.
Integrative Modeling Reveals Annexin A2-mediated Epigenetic Control of Mesenchymal Glioblastoma
Teresia Kling, Roberto Ferrarese, Darren Ó hAilín, Patrik Johansson, Dieter Henrik Heiland, Fangping Dai, Ioannis Vasilikos, Astrid Weyerbrock, Rebecka Jörnsten, Maria Stella Carro, Sven Nelander
EBioMedicine. 2016 Oct; 12: 72–85. Published online 2016 Sep 18. doi: 10.1016/j.ebiom.2016.08.050
PMCID: PMC5078587
c-Jun-N-terminal phosphorylation regulates DNMT1 expression and genome wide methylation in gliomas
Dieter H Heiland, Roberto Ferrarese, Rainer Claus, Fangping Dai, Anie P Masilamani, Eva Kling, Astrid Weyerbrock, Teresia Kling, Sven Nelander, Maria S Carro
Oncotarget. 2017 Jan 24; 8(4): 6940–6954. Published online 2016 Dec 28. doi: 10.18632/oncotarget.14330
PMCID: PMC5351681