High-quality products
Customized solutions
Personal contact
Fast service
Competent technical support +49(0)731-3608-123

rec. Human Interleukin-10 (rHuIL-10)

Advantages at a glance

  • High-quality products
  • Customized solutions
  • Personal contact
  • Fast service
  • Competent technical support +49(0)731-3608-123

€4,800.00*

Weight
Product number: C6077.1000
Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.

Shipment: not cooled. Stored at -20°C. For laboratory usage only!
Product information "rec. Human Interleukin-10 (rHuIL-10) "

IL10 is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Interleukin-10 is fully biologically active when compared to standard. The ED50 as determined by the dose-dependent co-stimulation (with murine IL-4) of MC/9 cells was found to be less than 2.0ng/mL, corresponding to a specific activity of 5.0×105 IU/mg. Amino acid composition: MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN.

Purity: >97.0% (by RP-HPLC, IEX-HPLC, SDS-PAGE). Less than 1% dimers and aggregates. Sterile Filtered White lyophilized (freeze-dried) powder. The ED50 as determined by the dose-dependent co-stimulation (with murine IL-4) of MC/9 cells was found to


Applikation / Application:
Einheiten / Units:
Quelle / Source:
CHO-cells


Sicherheits Hinweise / Safety


Klassifizierungen / Classification

eclass-Nr: 32-16-04-90
Documents - Protocols - Downloads :
Here you will find information and further literature. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.


Documents:

Product description
Category List
Listed below are articles and references, in which the authors trust in the high quality of this Genaxxon product.
Source: NCBI PubMed