High-quality products
Customized solutions
Personal contact
Fast service
Competent technical support +49(0)731-3608-123

rec. human Interleukin 13 (rHuIL-13)

Advantages at a glance

  • High-quality products
  • Customized solutions
  • Personal contact
  • Fast service
  • Competent technical support +49(0)731-3608-123

€225.00*

Weight
Product number: C6261.0010
Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.

Shipment: not cooled. Stored at -20°C. For laboratory usage only!
Product information "rec. human Interleukin 13 (rHuIL-13)"

IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL13 is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene together with IL3 >, IL4 >, IL5 >, and CSF2 > forms a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.

Rec. human Interleukin-13 produced in E.Coli is a single, non-glycosylated polypeptide chain of 112 amino acids and a molecular mass of 12 kDa.

Amino acid sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIE VAQFVKDLLLHLKKLFREGRFN.

Synonyms: NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.

Specifications:
Purity: min. 95% (HPLC and SDS-PAGE)
Lyophilized from a sterile filtered concentrated (1mg/mL) solution with 1xPBS pH7.2, 5% trehalose
Biological activity: The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be <1ng/mL, corresponding to a specific activity of >1 x 106units/mg.

 


Applikation / Application:
Einheiten / Units:
Quelle / Source:
Escherichia Coli


Sicherheits Hinweise / Safety


Klassifizierungen / Classification

eclass-Nr: 32-16-04-90
Documents - Protocols - Downloads :
Here you will find information and further literature. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.


Documents:

Product description
Category List
Listed below are articles and references, in which the authors trust in the high quality of this Genaxxon product.
Source: NCBI PubMed