Peptides & Proteins

Genaxxon bioscience offers peptides from various research areas as readily available in-stock peptides. These catalogue peptides come from the research fields: lipopeptides, MHC peptides, MS peptides, Alzheimer peptides / neuroscience, cancer & apoptosis and cell penetrating peptides (CPP). Of course, we also synthesize peptides on customer request. As a DIN ISO 9001-2015 certified company, we offer our customers the highest quality in the peptides we supply. The product portfolio includes standard peptides with a purity of 70% to> 95% and from 1mg up to 1g, but also isotopic labeled peptides, immunogenic peptides, peptides with post-translational modifications, peptides with a fluorescent label, biotin or other modifications.

Genaxxon bioscience is a peptide product and service company on the market since 2002. As DIN ISO 9001:2015 certified company we can offer high quality custom made peptides such as stable isotope-labeled peptides, immunogenic peptides, peptides with post-translational modifications, fluorescence labels, biotin or other modifications, peptide libraries or peptide pools.

For our customers working in the field of Alzheimer´s Disease, Multiple Sclerosis or immunogenic defects we offer from stock high quality peptides like "Cell Penetrating Peptides >", MHC-I and MCH-II Peptides >, Peptides for Alzheimer´s Disease > or Multiple Sclerosis > research. For details please search our online catalogue.

Besides the above mentioned peptides, Lipopeptides > as part of the outer membrane of Gram negative bacteria, Gram positive bacteria and mycoplasma, acting as cell activation signal via toll like receptors are offered by Genaxxon bioscience as purified products that can be ordered from stock.

Genaxxon bioscience offers peptides from various research areas as readily available in-stock peptides. These catalogue peptides come from the research fields: lipopeptides, MHC peptides, MS... read more »
Close window
Peptides & Proteins

Genaxxon bioscience offers peptides from various research areas as readily available in-stock peptides. These catalogue peptides come from the research fields: lipopeptides, MHC peptides, MS peptides, Alzheimer peptides / neuroscience, cancer & apoptosis and cell penetrating peptides (CPP). Of course, we also synthesize peptides on customer request. As a DIN ISO 9001-2015 certified company, we offer our customers the highest quality in the peptides we supply. The product portfolio includes standard peptides with a purity of 70% to> 95% and from 1mg up to 1g, but also isotopic labeled peptides, immunogenic peptides, peptides with post-translational modifications, peptides with a fluorescent label, biotin or other modifications.

Genaxxon bioscience is a peptide product and service company on the market since 2002. As DIN ISO 9001:2015 certified company we can offer high quality custom made peptides such as stable isotope-labeled peptides, immunogenic peptides, peptides with post-translational modifications, fluorescence labels, biotin or other modifications, peptide libraries or peptide pools.

For our customers working in the field of Alzheimer´s Disease, Multiple Sclerosis or immunogenic defects we offer from stock high quality peptides like "Cell Penetrating Peptides >", MHC-I and MCH-II Peptides >, Peptides for Alzheimer´s Disease > or Multiple Sclerosis > research. For details please search our online catalogue.

Besides the above mentioned peptides, Lipopeptides > as part of the outer membrane of Gram negative bacteria, Gram positive bacteria and mycoplasma, acting as cell activation signal via toll like receptors are offered by Genaxxon bioscience as purified products that can be ordered from stock.

Close filters
 
  •  
  •  
from to
1 From 21
No results were found for the filter!
[Ala13] Apelin QRPRLSHKGPMPA
[Ala13] Apelin QRPRLSHKGPMPA
Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands,...
From €180.50 * €190.00 *
NEW
[Ala9] Autocamtide 2 KKALRRQEAVDAL
[Ala9] Autocamtide 2 KKALRRQEAVDAL
From €171.00 * €180.00 *
[beta]-Amyloid (10-20) - YEVHHQKLVFF
[beta]-Amyloid (10-20) - YEVHHQKLVFF
[beta]-Amyloid (10-20) (peptide sequence: YEVHHQKLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-42 peptide. Amyloid-beta (1-42) human is an Alzheimer desease peptide. Characteristic of Alzheimer...
€200.85 *
NEW
[Des-octanoyl]-Ghrelin, human GSSFLSPEHQRVQQRKESKKPPAKLQPR
[Des-octanoyl]-Ghrelin, human...
Ghrelin for engl. Growth Hormone Release Inducing is an appetizing hormone found in the gastric mucosa and the pancreas. In addition to appetite stimulation, the hormone has a number of other effects. Ghrelin is a peptide hormone of 28...
From €318.25 * €335.00 *
NEW
[Des-octanoyl]-Ghrelin, rat GSSFLSPEHQKAQQRKESKKPPAKLQPR
[Des-octanoyl]-Ghrelin, rat...
Ghrelin for engl. Growth Hormone Release Inducing is an appetizing hormone found in the gastric mucosa and the pancreas. In addition to appetite stimulation, the hormone has a number of other effects. Ghrelin is a peptide hormone of 28...
From €318.25 * €335.00 *
[Phe17] Apelin KFRRQRPRLSHKGPMPF
[Phe17] Apelin KFRRQRPRLSHKGPMPF
Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands,...
From €226.10 * €238.00 *
3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK
3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK
The DYKDDDDK peptide was developed specifically for immunoaffinity chromatography. The peptide allows the competitive elution of proteins (amino terminal, metaminoterminal or carboxy-terminal) FLAG® fusion proteins from anti-FLAG M1 or...
From €275.50 * €290.00 *
Ac-KLVFF-NH2
Ac-KLVFF-NH2
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
From €149.59 *
NEW
ACTH (1-10), human SYSMEHFRWG
ACTH (1-10), human SYSMEHFRWG
ACTH (1-10), human SYSMEHFRWG is a synthetic peptide according to the first 10 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates...
From €85.50 * €90.00 *
NEW
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the amino acids 18 to 39 of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically,...
From €261.25 * €275.00 *
NEW
ACTH (4-10), human MEHFRWG
ACTH (4-10), human MEHFRWG
ACTH (4-10), human MEHFRWG is a synthetic peptide according to the amino acids 4 to 10 of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates...
From €85.50 * €90.00 *
NEW
ACTH(1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
ACTH(1-39), human...
ACTH(1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the first 39 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More...
From €441.75 * €465.00 *
1 From 21