Peptides & Proteins

Genaxxon bioscience is a peptide product and service company on the market since 2002. As DIN ISO 9001:2008 certified company we can offer high quality custom made peptides such as stable isotope-labeled peptides, immunogenic peptides, peptides with post-translational modifications, fluorescence labels, biotin or other modifications, peptide libraries or peptide pools.

For our customers working in the field of Alzheimer´s Disease, Multiple Sclerosis or immunogenic defects we do offer from stock high quality peptides like "Cell Penetrating Peptides", MHC-I and MCH-II peptides, peptides for Alzheimer´s Disease or Multiple Sclerosis research. For details please search our online catalogue.

Besides the above mentioned peptides, Lipopeptides as part of the outer membrane of Gram negative bacteria, Gram positive bacteria and mycoplasma, acting as cell activation signal via toll like receptors as well as siderophores (Siderophore = Greek for iron carrier) an iron chelating compound secreted by microorganisms to utilize Fe3+ ions at neutral pH are offered by Genaxxon bioscience as purified products that can be ordered from stock.

Genaxxon bioscience is a peptide product and service company on the market since 2002. As DIN ISO 9001:2008 certified company we can offer high quality custom made peptides such as stable... read more »
Close window
Peptides & Proteins

Genaxxon bioscience is a peptide product and service company on the market since 2002. As DIN ISO 9001:2008 certified company we can offer high quality custom made peptides such as stable isotope-labeled peptides, immunogenic peptides, peptides with post-translational modifications, fluorescence labels, biotin or other modifications, peptide libraries or peptide pools.

For our customers working in the field of Alzheimer´s Disease, Multiple Sclerosis or immunogenic defects we do offer from stock high quality peptides like "Cell Penetrating Peptides", MHC-I and MCH-II peptides, peptides for Alzheimer´s Disease or Multiple Sclerosis research. For details please search our online catalogue.

Besides the above mentioned peptides, Lipopeptides as part of the outer membrane of Gram negative bacteria, Gram positive bacteria and mycoplasma, acting as cell activation signal via toll like receptors as well as siderophores (Siderophore = Greek for iron carrier) an iron chelating compound secreted by microorganisms to utilize Fe3+ ions at neutral pH are offered by Genaxxon bioscience as purified products that can be ordered from stock.

Filter
Close filters
 
  •  
  •  
from to
1 From 20
No results were found for the filter!
[beta]-Amyloid (10-20) - YEVHHQKLVFF
[beta]-Amyloid (10-20) - YEVHHQKLVFF
[beta]-Amyloid (10-20) (peptide sequence: YEVHHQKLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-42 peptide. Amyloid-beta (1-42) human is an Alzheimer desease peptide. Characteristic of Alzheimer...
€195.00 *
[beta]-Amyloid (16-20) - KLVFF
[beta]-Amyloid (16-20) - KLVFF
[beta]-Amyloid (16-20) (peptide sequence: KLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-40 peptide. Biotinylated amyloid-ß-peptides: Biotinylated peptides are a useful tool in many important...
From €145.23 *
human growth hormon releasing factor 6
[D-Lys3]-GHRP-6
[D-Lys3]-GHRP6 (growth hormone releasing peptide 6) induces the secretion of growth hormone (GH). In the membrane of clonal GC somatotropes, this peptide elevates the number of functional voltage-gated Ca2+ and Na+ channels. Chronic...
From €95.00 *
3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK
3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK
The DYKDDDDK peptide was developed specifically for immunoaffinity chromatography. The peptide allows the competitive elution of proteins (amino terminal, metaminoterminal or carboxy-terminal) FLAG® fusion proteins from anti-FLAG M1 or...
€375.00 *
Ac-KLVFF-NH2
Ac-KLVFF-NH2
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
From €145.23 *
Accutase® Cell Detachment Solution - 100 mL
Accutase® Cell Detachment Solution - 100 mL
Accutase® as a cell detachment solution of proteolytic and collagenolytic enzymes useful for the routine detachment of cells from standard tissue culture plastic ware and adhesion coated plastic ware. The reagent is useful for creating...
€65.04 *
Albumin from egg - Ovalbumin
Albumin from egg - Ovalbumin
Albumin from chicken egg (Ovalbumin). Min. 98% protein. May be used as standard for molecular mass determination in PAGE.
From €203.14 *
alpha-Chymotrypsin (EC 3.4.21.1), grade I
alpha-Chymotrypsin (EC 3.4.21.1), grade I
α-Chymotrypsin is a serine peptidase that hydrolyzes peptide bonds with aromatic or large hydrophobic side chains (Tyr, Trp, Phe, Leu) on the carboxyl end of the bond. Ca2+ activates and stabilizes the enzyme. The enzyme has 241 amino...
From €60.21 *
Amyloid-beta (1-40) human - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Amyloid-beta (1-40) human -...
Amyloid-beta (1-40) human is an Alzheimer desease peptide. Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which...
From €220.60 *
Amyloid-beta (1-40) human (HCl-salt)
Amyloid-beta (1-40) human (HCl-salt)
Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly....
From €364.66 *
Amyloid-beta (1-40) rat
Amyloid-beta (1-40) rat
Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly....
From €220.60 *
Amyloid-beta (1-40) rat (HCl-salt)
Amyloid-beta (1-40) rat (HCl-salt)
Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly....
From €364.66 *
1 From 20
Accutase Cell Lysozyme from Collagenase PADRE - Peptide MOG 35-55 human Bovine albumin Collagenase Cas9-NLS CRISPR Cas9-Dead-NLS rec. Human TEV Protease - esiCRISPR FSL-1-Biotin PamCys Pam Hyaluronidase FSL-1-Fluoresce Melan-A MART-1 MDYKDHDG-DYKDHD Collagenase Ac-KLVFF-NH2 MALP-2-DI Trypsin from Growth Hormone Lysozyme from Human Chorionic Cas9-NLS-EGFP Cas9-Dead-NLS-E MALP-2-DI Lysostaphin Zymolyase R Zymolyase R EBNA-1 Protein D-Lys3 -GHRP-6 Influenza A NP TAT 48-60 MAGE-3 antigen MDYKDDDDK Cas9-Nickase-NL Pam3CysGSHQMKSE Collagenase FSL-1 TLR2 TLR6 Cas9-NLS-tagRFP Lens culinaris L-Asparaginase Natural mouse Pam3Cys-SKKKK
This website uses cookies to ensure you get the best experience on our website.
Ok, got it