Control peptide Amyloid-beta (40-1) human

Control peptide Amyloid-beta (40-1) human

Order number: P2252.0001

Shipping: shipped at RT, store at -20°C

Ready to ship today,
Delivery time 1-3 workdays

€234.04 *


Please select the favoured pack size.


Please select the favoured purity.

Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques... more
Product information "Control peptide Amyloid-beta (40-1) human"

Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly. The amyloid-ß-peptides are fragments of the broadly distributed, membrane-bound amyloid precursor protein APP, encoded on chromosome 21. They are formed from the proteolytic cleavage of APP by ß- and g-secretases. Cleavage occurs after residue 40 or after residue 42. Even slightly increased amounts of amyloid-ß1-42 are described to be sufficient to cause Alzheimer's disease.

Related products:
P2255 - Amyloid-beta (16-20) - KLVFF >
P2304 - Amyloid-beta (10-20) - YEVHHQKLVFF >
P2250 - Amyloid-beta (1-40) human - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >
P2248 - Amyloid-beta (1-40) rat - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >

More products around "Control peptide Amyloid-beta (40-1) human"
Specifications: Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD Purity: >95% (HPLC)... more

Technical Data:

Purity: >95% (HPLC)
Appearance: lyophilized, white powder



Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads more

Dokumente - Protokolle - Downloads

Here you will find information and further literature on Control peptide Amyloid-beta (40-1) human. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: or phone: +49 731 3608 123.

Read, write and discuss reviews... more
Customer evaluation for "Control peptide Amyloid-beta (40-1) human"
Write an evaluation
Evaluations will be activated after verification.
Please enter these characters in the following text field.

The fields marked with * are required.