Biotinylated Amyloid-beta (1-40) rat

Biotinylated Amyloid-beta (1-40) rat

Order number: P2253.0001

Shipping: shipped at RT, store at -20°C

Ready to ship today,
Delivery time 1-3 workdays

€457.92 *


Please select the favoured pack size.


Please select the favoured purity.

Biotinylated amyloid-ß (1-40) peptide from rat. Biotinylated peptides are a useful tool in many... more
Product information "Biotinylated Amyloid-beta (1-40) rat"

Biotinylated amyloid-ß (1-40) peptide from rat. Biotinylated peptides are a useful tool in many important applications. Biotin has a strong affinity for avidin or streptavidin. This interaction can be used for qualitative and quantitative detection, labelling or immobilisation. The biotinylated amyloid-ß peptides are N-terminally labelled. Two 6-aminohexanoic acid residues are inserted as spacer between the amyloid-ß peptide itself and biotin. The enlarged distance minimise steric hindrance and improve the availability of biotin for avidin or streptavidin binding.

Related products:
P2255 - Amyloid-beta (16-20) - KLVFF >
P2304 - Amyloid-beta (10-20) - YEVHHQKLVFF >
P2250 - Amyloid-beta (1-40) human - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >
P2248 - Amyloid-beta (1-40) rat - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >

More products around "Biotinylated Amyloid-beta (1-40) rat"
Specifications: Sequence: Biotin-Aca-Aca-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV Purity:... more

Technical Data:

Purity: >95% (HPLC).



Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads more

Dokumente - Protokolle - Downloads

Here you will find information and further literature on Biotinylated Amyloid-beta (1-40) rat. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: or phone: +49 731 3608 123.