RIIGL - Inhibitor Peptide of amyloid-ß

RIIGL - Inhibitor Peptide of amyloid-ß

Order number: P2257.7005

Shipping: shipped at RT, store at -20°C

Ready to ship today,
Delivery time 1-3 workdays

€153.83 *


Please select the favoured pack size.


Please select the favoured purity.

RIIGL is one of several inhibitors of amyloid-beta aggregation that have been published. Many of... more
Product information "RIIGL - Inhibitor Peptide of amyloid-ß"

RIIGL is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about peptides that target amyloid-beta is described by Stains et al. (2007) ChemMedChem 2, 1674-1692.

Characteristic of Alzheimer disease is the accumulation of amyloid plaques (amyloid-beta) in the brain. The major components of these plaques are 36-42 residue-long amyloid-beta-peptides, which form insoluble fibrils via self-assembly.
The amyloid-beta-peptides are fragments of the broadly distributed, membrane-bound amyloid precursor protein APP, encoded on chromosome 21. They are formed from the proteolytic cleavage of APP by ß- and γ-secretases.
One of the most common and intensively studied amyloid ß isoforms is amyloid ß1-40), which is present in amyloid plaques.

M. Ahmed, J. Davis, D. Aucoin, T. Sato, S. Ahuja, S. Aimoto, J. I. Elliott, W. E. Van Nostrand, S. O. Smith (2010) Nat. Struct. Mol. Biol. 17, 561-567.
T. Hartmann, S. C. Bieger, B. Brühl, P. J. Tienari, N. Ida, D. Allsop, G. W. Roberts, C. L. Masters, C. G. Dotti, K. Unsicker, K. Beyreuther (1997) Nat. Med. 3, 1016-1020.

Amyloid-ß-peptides and innate immunity
In Alzheimer’s disease, deposition of amyloid-beta triggers a protracted sterile inflammatory response. Chronic stimulation of the innate immune system is believed to underlie the pathology of this disease. It was shown, that amyloid-beta triggers inflammatory signalling through a heterodimer of Toll-like receptors 4 and 6. Assembly of this recently identified heterodimer is regulated by signals from the scavenger receptor CD36, CD36-TLR4-TLR6 activation was identified as a common molecular mechanism by which atherogenic lipids and amyloid-beta stimulate sterile inflammation (Stewart et al. 2010, Nature Immunology 11, 155-161 doi:10.1038/ni.1836).

Related products:
P2255 - Amyloid-beta (16-20) - KLVFF >
P2304 - Amyloid-beta (10-20) - YEVHHQKLVFF >
P2250 - Amyloid-beta (1-40) human - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >
P2248 - Amyloid-beta (1-40) rat - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >

More products around "RIIGL - Inhibitor Peptide of amyloid-ß"
Specifications: Sequence: RIIGL Purity: >70% / >95% (HPLC) Appearance: lyophilized,... more

Technical Data:

Sequence: RIIGL
Purity: >70% / >95% (HPLC)
Appearance: lyophilized, white powder


study of Alzheimer desease Fibrilization, fibrillogenesis studies



Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads more

Dokumente - Protokolle - Downloads

Here you will find information and further literature on RIIGL - Inhibitor Peptide of amyloid-ß. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.

Read, write and discuss reviews... more
Customer evaluation for "RIIGL - Inhibitor Peptide of amyloid-ß"
Write an evaluation
Evaluations will be activated after verification.
Please enter these characters in the following text field.

The fields marked with * are required.