human LL-37 [LL-37, 37 aa]

Order number: P2299.9501
Shipping: shipped at RT, store at -20°C Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.
Quantity | Unit price |
---|---|
To 2 | €306.43 * |
From 3 | €245.14 * |
Prices plus VAT plus shipping costs
LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria. Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution.
Amino acid sequence: [LL-37, 37 aa] (Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser)
Technical Data:
Specifications:
Purity: >70% (HPLC)
Sequence: [LL-37, 37 aa]
Sequence (three letter code): Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
C205H341N61O52
MW = 4493.3 g/mol
Lyophilized white powder
application:
LL-37 is used to study host defense mechanisms.Source
syntheticSicherheits Hinweise / Safety
Klassifizierungen / Classification
eclass-Nr: 34-16-04-90Dokumente - Protokolle - Downloads
Here you will find information and further literature on human LL-37 [LL-37, 37 aa] For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.