human LL-37 [LL-37, 37 aa]
Advantages at a glance
- High-quality products
- Customized solutions
- Personal contact
- Fast service
- Competent technical support +49(0)731-3608-123
| Quantity | Unit price |
|---|---|
| To 2 |
€705.50*
|
| From 3 |
€564.40*
€705.50*
(20% saved)
|
Available in 1 day, delivery time 24 days
Delivery time 24 days
Shipment: not cooled. Store at -20°C. For laboratory usage only!
LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria. Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution.
Amino acid sequence: [LL-37, 37 aa] (Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser)
Specifications:
Purity: >70% (HPLC)
Sequence: [LL-37, 37 aa]
Sequence (three letter code): Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
C205H341N61O52
MW = 4493.3 g/mol
Lyophilized white powder
Sicherheits Hinweise / Safety
Klassifizierungen / Classification
eclass-Nr: 32-16-04-09
Documents:
CertificateGeneral Data 1
Source: NCBI PubMed