ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Advantages at a glance
- High-quality products
- Customized solutions
- Personal contact
- Fast service
- Competent technical support +49(0)731-3608-123
Quantity | Unit price |
---|---|
To 2 |
€465.00*
|
From 3 |
€441.75*
€465.00*
(5% saved)
|
Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.
Shipment: not cooled. Store at -20°C. For laboratory usage only!
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the first 39 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates secretion of glucocorticoids such as cortisol, and has little control over secretion of aldosterone, the other major steroid hormone from the adrenal cortex. Stimulates secretion of adrenal corticosteroids and induces growth of adrenal cortex. ACTH also called Tetracosactide directly activates G-proteins. It is also a stimulator of adenylate cyclase and cAMP formation.
Specifications:
Purity: >95% (HPLC, 214nm)
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Sequence (three letter code): Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
chemical formula: C207H308N56O58S
Molecular Weight: 4541.13 g/mol
Appearance: lyophilized white powder
Sicherheits Hinweise / Safety
Klassifizierungen / Classification
eclass-Nr: 32-16-04-09
Documents:
General Data 1Source: NCBI PubMed