MAGE-A3 Peptide Pool

MAGE-A3 Peptide Pool


Order number: P2965.70PP

Shipping: shipped at RT, store at -20°C

Ready to ship today,
Delivery time 1-3 workdays

€210.00 *

Purity:

Please select the favoured purity.

MAGE-A3 Control Pool of 76peptides derived from a peptide scan (15mers with 11 aa overlap)... more
Product information "MAGE-A3 Peptide Pool"

MAGE-A3 Control Pool of 76peptides derived from a peptide scan (15mers with 11 aa overlap) through Melanoma-associated antigen 3 (MAGEA3) (UniProt ID: P43357) of Homo sapiens (Human) for T cell assay.

Length of Melanoma-associated antigen 3: 314amino acids
Sequence:
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEE
GPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLG
DNQIMPKAGLLIIVLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHH
MVKISGGPHISYPPLHEWVLREGEE

More products around "MAGE-A3 Peptide Pool"
Specifications: Purity: >70% (HPLC) Amount: approx. 25µg of each peptide Origin/Protein:... more
 

Technical Data:

Specifications:
Purity: >70% (HPLC)
Amount: approx. 25µg of each peptide
Origin/Protein: Melanoma-associated antigen 3
Organism: Homo sapiens (Human)
UniProtKB - P43357
lyophilized white powder

application:

Usage: T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response Indication(s)/Topic(s): Cancer, Melanoma

Source

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads more

Dokumente - Protokolle - Downloads

Here you will find information and further literature on MAGE-A3 Peptide Pool. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.

 
 
 
Read, write and discuss reviews... more
Customer evaluation for "MAGE-A3 Peptide Pool"
Write an evaluation
Evaluations will be activated after verification.
Please enter these characters in the following text field.

The fields marked with * are required.