SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilized Trimer



Order number: S5333.0100

Shipping: shipped on dry ice, stored at -80°C

Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.

€528.00 *

Weight:

Please select the favoured pack size.

The engineered recombinant Sars-Co-V-2 Spike S1 protein contains specific amino acid... more
Product information "SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilized Trimer"

The engineered recombinant Sars-Co-V-2 Spike S1 protein contains specific amino acid substitutions to stabilize the prefusion conformation (2P). Furthermore, the furin cleavage site at the boundary between the S1/S2 subunits was deleted and an artificial trimerization domain was added to the C-terminal end of the monomer. Above all, the spike is a major immunogen and an interesting target for vaccine development as well as for serological assays.

 

The SARS-CoV-2 spike is presented as a trimeric structure on the surface of the virus. It consists of three identical transmembrane proteins, called spike proteins, each containing two subunits: the S1 and the S2 subunit. The S1 is necessary for the recognition of the receptor on the surface of a susceptible cell. In addition, the S2 subunit is responsible for the fusion of the virus with the cell membrane of the host cell. Upon binding of the host receptor hACE2, the distal S1 domain is cleaved. This reveals the fusion machinery of the S2 subunit, which mediates the entry into the cell. Moreover, the Spike protein is heavily glycosylated by N-linked glycans that are important for the proper folding of the protein and the recognition by neutralizing antibodies.

 

Protein sequence:
Sequence without tags (AS 16-1211): VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCN DPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGW TAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCY GVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPT NGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVP VAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPGASVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDST ECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIA QYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQID RLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQII TTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKY

RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2

SARS-CoV-2 (2019-nCoV) Spike S1 Protein can be used for the development of diagnostic kits. It is not for direct detection of SARS-Cov-2. The counterpart to SARS-CoV-2 is ACE2 (angiotensin converting enzyme-2), which has previously been described as a receptor for SARS-CoV.

 

 

More products around "SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilized Trimer"
Specifications: Formulation: PBS, 5% (w/v) Trehalose, pH7.4 Format: Liquid, stored and shipped... more
 

Technical Data:

Specifications:
Formulation: PBS, 5% (w/v) Trehalose, pH7.4
Format: Liquid, stored and shipped at -80°C
Purity: >85% as determined by SDS-PAGE
with C-terminal His-Tag and Strep-Tag
MW: about 260 kDa

Expression host: human, HEK293
Species: Wuhan seafood market pneumonia virus; 2019-nCoV

Source

human, HEK293

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads more


Dokumente - Protokolle - Downloads

Here you will find information and further literature on SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilized Trimer. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.