Variant Omicron B.1.1.529 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein)

Variant Omicron B.1.1.529 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein)


Order number: P2780.0315

Shipping: Shipment: not cooled. Store at -20°C. For laboratory usage only!

Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.

GENAXXON Jubilee 20th Anniversary

 

€836.58 *

pack size:

Please select the favoured pack size.

This peptide pool of the omicron variant of SARS-CoV-2 (315 peptides, delivered in two... more
Product information "Variant Omicron B.1.1.529 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein)"

This peptide pool of the omicron variant of SARS-CoV-2 (315 peptides, delivered in two subpools of 158 & 157 peptides) that covers the whole spike glycoprotein with all mutations.

Possilbe applications: T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response.

Each peptide is purified by solid phase extraction and checked on its purity by ESI-MS.
The peptides of this product are supplied lyophilized as trifluoro acetate salts.

Peptide Scan 15/11
Length: 1270 amino acids
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHVISGTNGTKRFDNPVLPFNDGVYFASIEKSNIIRGWIFGTTLDSK
TQSLLIVNNATNVVIKVCEFQFCNDPFLDHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPIIVREPEDLPQGFSALE
PLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCP
FDEVFNATRFASVYAWNRKRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVSG
NYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLKSYGFQPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLKGTGVLTESN
KKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEYVNNSYECDIPIG
AGICASYQTQTKSHRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLKRALTGIAVEQDKNTQ
EVFAQVKQIYKTPPIKYFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFKGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGA
ALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNHNAQALNTLVKQLSSKFGAISSVLNDIFSRLDKVEAEVQIDRLITGRLQSLQ
TYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQ
IITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIV
MVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

More products around "Variant Omicron B.1.1.529 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein)"
Gene: S   No Peptides: 315 peptides   Amount Peptide: 25... more
 

Technical Data:

Gene: S  
No Peptides: 315 peptides  
Amount Peptide: 25 µg  
Amount Aliquote: 7,875 mg  
Uniprot Id: P0DTC2  
Solubility: Dissolve in a minimum amount of pure DMSO (approx. 40μl) and dilute with water to the desired concentration. Please pay attention that the final concentration of DMSO must be below 1% (v/v) to avoid toxicity in the biological  
Storage: Store at -20°C  
Purity: Each peptide ESI-MS checked, pool is purified by solid phase extraction  
Counter Ion: TFA  
Protein: Spike glycoprotein  
Species: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)  
Application : T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response  
Indication : Covid-19, Infection, Respiratory infection  

application:

T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response

Source

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 32-16-04-09
Dokumente - Protokolle - Downloads more


Dokumente - Protokolle - Downloads

Here you will find information and further literature on Variant Omicron B.1.1.529 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein). For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.