Hormones

Genaxxon bioscience offers a wide range of well characterized recombinant and natural hormones that are offered as highly pure lyophilized powder. Among these hormones are: ACTH - Antide - Argipressin - Atosiban - Buserelin - Cetrorelix - DDAVP - Deslorelin - Elcatonin - Exenatide - Ganirelix - GHRL - GHRP-6 - Glucagon - Goserelin - Hexarelin - hFSH - hGHRH - hGHRP-2 - hGLP-1 - Histrelin - hLeuprolide - hLHRH - hMG - hPTH (aa 1-34) - hTSH - HuTRH - Lanreotide - Lypressin - MT-II - NAF - OCT - OT - PMSG - Pramlintide - rExendin-4 - rhCG - rhLHRH - rHuAGRP - rHuFSH - rHuGLP-1 - rHuGlucagon - rHuIAPP - rHuOXM - rHuProcalcitonin - rHuProguanylin - rHuProuroguanylin - rHuPTH (aa 1-34) - rHuPTH (aa 1-84) - rHuPTH (aa 7-34) - rHuSTC-1 - rHuSTC-2 - rHuThyrostimulin-A - rHuThyrostimulin-B - rHuTSH - sCT - Secretin - Sincalide - SST - Ta1 - Tb4 - Terlipressin - TP-5 - Trp - Vasopressin.

Genaxxon bioscience offers a wide range of well characterized recombinant and natural hormones that are offered as highly pure lyophilized powder. Among these hormones are: ACTH - Antide -... read more »
Close window
Hormones

Genaxxon bioscience offers a wide range of well characterized recombinant and natural hormones that are offered as highly pure lyophilized powder. Among these hormones are: ACTH - Antide - Argipressin - Atosiban - Buserelin - Cetrorelix - DDAVP - Deslorelin - Elcatonin - Exenatide - Ganirelix - GHRL - GHRP-6 - Glucagon - Goserelin - Hexarelin - hFSH - hGHRH - hGHRP-2 - hGLP-1 - Histrelin - hLeuprolide - hLHRH - hMG - hPTH (aa 1-34) - hTSH - HuTRH - Lanreotide - Lypressin - MT-II - NAF - OCT - OT - PMSG - Pramlintide - rExendin-4 - rhCG - rhLHRH - rHuAGRP - rHuFSH - rHuGLP-1 - rHuGlucagon - rHuIAPP - rHuOXM - rHuProcalcitonin - rHuProguanylin - rHuProuroguanylin - rHuPTH (aa 1-34) - rHuPTH (aa 1-84) - rHuPTH (aa 7-34) - rHuSTC-1 - rHuSTC-2 - rHuThyrostimulin-A - rHuThyrostimulin-B - rHuTSH - sCT - Secretin - Sincalide - SST - Ta1 - Tb4 - Terlipressin - TP-5 - Trp - Vasopressin.

Close filters
  •  
  •  
  •  
  •  
 
from to
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
No results were found for the filter!
human growth hormon releasing factor 6 [D-Lys3]-GHRP-6
[D-Lys3]-GHRP6 (growth hormone releasing peptide 6) induces the secretion of growth hormone (GH). In the membrane of clonal GC somatotropes, this peptide elevates the number of functional voltage-gated Ca2+ and Na+ channels. Chronic...
From €122.94 * €136.59 *
[Des-octanoyl]-Ghrelin, human GSSFLSPEHQRVQQRKESKKPPAKLQPR [Des-octanoyl]-Ghrelin, human...
Ghrelin for engl. Growth Hormone Release Inducing is an appetizing hormone found in the gastric mucosa and the pancreas. In addition to appetite stimulation, the hormone has a number of other effects. Ghrelin is a peptide hormone of 28...
From €318.25 * €335.00 *
[Des-octanoyl]-Ghrelin, rat GSSFLSPEHQKAQQRKESKKPPAKLQPR [Des-octanoyl]-Ghrelin, rat...
Ghrelin for engl. Growth Hormone Release Inducing is an appetizing hormone found in the gastric mucosa and the pancreas. In addition to appetite stimulation, the hormone has a number of other effects. Ghrelin is a peptide hormone of 28...
From €318.25 * €335.00 *
[Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR [Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR
[Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. While the normal peptide does contain a Glycin at position 10 this Glycin...
€238.00 *
Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR
Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically,...
€238.00 *
ACTH (1-10), human SYSMEHFRWG ACTH (1-10), human SYSMEHFRWG
ACTH (1-10), human SYSMEHFRWG is a synthetic peptide according to the first 10 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates...
From €72.00 * €90.00 *
ACTH (1-16), human SYSMEHFRWGKPVGKK ACTH (1-16), human SYSMEHFRWGKPVGKK
ACTH (1-16), human SYSMEHFRWGKPVGKK is a synthetic peptide according to the first 16 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it...
€238.00 *
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39), human...
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the first 39 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex....
From €441.75 * €465.00 *
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the amino acids 18 to 39 of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically,...
From €261.25 * €275.00 *
ACTH (4-10), human MEHFRWG ACTH (4-10), human MEHFRWG
ACTH (4-10), human MEHFRWG is a synthetic peptide according to the amino acids 4 to 10 of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates...
From €85.50 * €90.00 *
Antide Acetate Antide Acetate
Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s body to represses FSH and LH releases that stem from the pituitary gland. Synthetic versions of this chemical have been developed for...
From €192.33 *
Growth-hormone-releasing hormone (GHRH) Growth-hormone-releasing hormone (GHRH)
Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or GHRF) or somatocrinin, is a 44-amino acid peptide hormone produced in the arcuate nucleus of the hypothalamus. GHRH is released from...
From €174.45 *
hGHRP-2 / Human Growth Hormone Releasing Peptide-2 hGHRP-2 / Human Growth Hormone Releasing Peptide-2
Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs to stimulate GH release. GHRP-2, an investigational drug, is one of the most potent...
From €140.69 *
human FSH - Follicle stimulating Hormone human FSH - Follicle stimulating Hormone
Follicle stimulating hormone (FSH) is a hormone synthesised and secreted by gonadotropes in the anterior pituitary gland. FSH and LH act synergistically in reproduction in women, in the ovary FSH stimulates the growth of immature...
From €153.83 *
LH - Luteinizing Hormone from procine LH - Luteinizing Hormone from procine
Porcine Luteinizing Hormone is a glycosylated, polypeptide chain which stimulates maturation of follicle, induces ovulation, accelerates formation of corpus luteum and secretion of pregnanolone. Porcine Luteinizing Hormone delays ovulation.
From €122.00 *
rhCG - Corticotropin releasing hormone binding protein rhCG - Corticotropin releasing hormone binding...
CRH is a powerful stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. CRH concentration in the human peripheral circulation is usually low. The concentration rises during pregnancy and fall back quickly after...
From €140.69 *
rhuPTH - recombinant human Parathyroid Hormon (aa 1-34) rhuPTH - recombinant human Parathyroid Hormon...
Synonyms: Parathyrin, PTH, Parathormone. Rec. Parathyroid Hormone Human (C181H290N55O51S2) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 34 amino acids and having a molecular mass of 4117.8 Dalton.
From €318.80 *