The Genaxxon online shop offers our customers a quick and easy way to browse the wide range of products for Realtime PCR, Molecular Biology, Cell Biology, but also for many other priorities. Here you can order your desired products. You have the choice of various types and product sizes. The Genaxxon page has two ways for searching. You can just enter the search term in the free text search (top right) and see the search results appear, or you look at the category in the menu bar on the left side and obtain in this way an overview of the extensive range.

The Genaxxon online shop offers our customers a quick and easy way to browse the wide range of products for Realtime PCR, Molecular Biology, Cell Biology, but also for many other priorities. Here... daha fazla oku »
Pencereyi kapat

The Genaxxon online shop offers our customers a quick and easy way to browse the wide range of products for Realtime PCR, Molecular Biology, Cell Biology, but also for many other priorities. Here you can order your desired products. You have the choice of various types and product sizes. The Genaxxon page has two ways for searching. You can just enter the search term in the free text search (top right) and see the search results appear, or you look at the category in the menu bar on the left side and obtain in this way an overview of the extensive range.

Filtre
Filtreleri kapat
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
 
gönderen alıcı
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
1 Gönderen 3
Filtre için sonuç bulunamadı!
Aphidicolin chemical structure (+)-Aphidicolin, high pure
Aphidicolin inhibits the growth of eukaryotic cells and certain animal viruses by selectively inhibiting the cellular replication of DNA polymerase II or the viral-induced DNA polymerases. The drug may be useful for controlling excessive...
Gönderen 339,15 € *
[Ala13] Apelin QRPRLSHKGPMPA [Ala13] Apelin QRPRLSHKGPMPA
Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands,...
Gönderen 140,00 € * 175,00 € *
[Ala9] Autocamtide 2 - KKALRRQEAVDAL [Ala9] Autocamtide 2 - KKALRRQEAVDAL
Gönderen 146,25 € * 195,00 € *
[alpha]-Bag Cell Peptide (1 - 7) - APRLRFY [alpha]-Bag Cell Peptide (1 - 7) - APRLRFY
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia(1). They trigger a series of reproductive behavior in this mollusk that finally culminates in...
Gönderen 100,00 € * 125,00 € *
[alpha]-Bag Cell Peptide (1 - 9) - APRLRFYSL [alpha]-Bag Cell Peptide (1 - 9) - APRLRFYSL
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia(1). They trigger a series of reproductive behavior in this mollusk that finally culminates in...
Gönderen 100,00 € * 125,00 € *
[beta]-Amyloid (10-20) - YEVHHQKLVFF [beta]-Amyloid (10-20) - YEVHHQKLVFF
[beta]-Amyloid (10-20) (peptide sequence: YEVHHQKLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-42 peptide. Amyloid-beta (1-42) human is an Alzheimer desease peptide. Characteristic of Alzheimer...
242,05 € *
[beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS [beta]-Amyloid/A4 Protein Precursor (APP) (328...
Amino acid sequence RERMS represents the active domain of amyloid beta/A4 protein precursor that promotes fibroblast growth; H. Ninomiya, et al.; J. Cell. Biol. 121, 879 (1993). The characteristic of Alzheimer disease is the accumulation...
100,26 € *
[beta]-Bag Cell Peptide - RLRFH [beta]-Bag Cell Peptide - RLRFH
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia(1). They trigger a series of reproductive behavior in this mollusk that finally culminates in...
Gönderen 85,50 € * 90,00 € *
[Des-octanoyl]-Ghrelin, human GSSFLSPEHQRVQQRKESKKPPAKLQPR [Des-octanoyl]-Ghrelin, human...
Ghrelin for engl. Growth Hormone Release Inducing is an appetizing hormone found in the gastric mucosa and the pancreas. In addition to appetite stimulation, the hormone has a number of other effects. Ghrelin is a peptide hormone of 28...
Gönderen 318,25 € * 335,00 € *
[Des-octanoyl]-Ghrelin, rat GSSFLSPEHQKAQQRKESKKPPAKLQPR [Des-octanoyl]-Ghrelin, rat...
Ghrelin for engl. Growth Hormone Release Inducing is an appetizing hormone found in the gastric mucosa and the pancreas. In addition to appetite stimulation, the hormone has a number of other effects. Ghrelin is a peptide hormone of 28...
Gönderen 318,25 € * 335,00 € *
[Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR [Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR
[Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. While the normal peptide does contain a Glycin at position 10 this Glycin...
238,00 € *
[Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV [Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV
[Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV - (HLA-A*02:01) an analog of Melan-A, with Leu substituted for Ala at position 27, shows better HLA-A*0201 binding properties as well as better immunogenicity and antigenicity than the...
Gönderen 74,16 € * 92,70 € *
[Phe17] Apelin KFRRQRPRLSHKGPMPF [Phe17] Apelin KFRRQRPRLSHKGPMPF
Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands,...
Gönderen 226,10 € * 238,00 € *
Tryspin/EDTA - 0.05% Trypsin and 0.02% EDTA in PBS 0.05% Trypsin in PBS with 0.02% EDTA, w/o Mg2+,...
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.05% Trypsin is produced by dilution of Trypsin in PBS. Due to its protease activities, trypsin solutions are widely used for cell dissociation, routine cell culture...
Gönderen 14,95 € *
Trypsin_EDTA for cell culture 0.05% Trypsin in PBS with 0.02% EDTA, with...
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.05% Trypsin is produced by dilution of Trypsin in PBS. Due to its protease activities, trypsin solutions are widely used for cell dissociation, routine cell culture...
Gönderen 13,53 € *
Trypsin EDTA for cell culture 0.05% Trypsin and 0.1% EDTA in PBS w/o Mg2+,...
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.05% Trypsin is produced by dilution of Trypsin in PBS. Due to its protease activities, trypsin solutions are widely used for cell dissociation, routine cell culture...
Gönderen 16,50 € *
ethidium bromide 0.07% solution 0.07 % Ethidium bromide
(2,7-Diamino-10-ethyl-9-phenylphenanthridium bromide) Ethidium bromide is an intercalating agent for nucleic acids. It is widely used for staining of nucleic acids after electrophoresis on agarose or acrylamide gels and for fluorescent...
Gönderen 58,93 € *
İpucu!
0,1mm Beads G2 DNA/RNA Extraction-Enhancer GENAXXON bioscience 0.1mm Beads of G2 DNA/RNA Extraction Enhancer
G2 DNA/RNA Enhancer for improved DNA/RNA extraction! The G2 DNA/RNA Enhancer is developed to increase the yield of microbial DNA during DNA extraction from difficult matrices for example clay and soil samples. The primary function of G2...
Gönderen 125,00 € *
0.25% Trypsin in HBSS with 1mM EDTA, w/o Mg and Ca, with Phenol red 0.25% Trypsin in HBSS with 1mM EDTA, w/o Mg and...
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.25% Trypsin is produced by dilution of Trypsin in HBSS. Due to its protease activities, trypsin solutions are widely used for cell dissociation, routine cell culture...
Gönderen 19,99 € *
0.25% Trypsin in PBS w/o Mg and Ca 0.25% Trypsin in PBS w/o Mg and Ca
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.25% Trypsin is produced by dilution of Trypsin in PBS. Due to its protease activities, trypsin solutions are widely used for cell dissociation, routine cell culture...
Gönderen 15,91 € *
0.25% Trypsin in PBS with 0.02% EDTA 0.25% Trypsin in PBS with 0.02% EDTA
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.25% Trypsin is produced by dilution of Trypsin in PBS. Due to its protease activities, trypsin solutions are widely used for cell dissociation, routine cell culture...
Gönderen 13,85 € *
0.25% Trypsin in PBS with 0.02% EDTA with Phenol red 0.25% Trypsin in PBS with 0.02% EDTA with...
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.25% Trypsin is produced by dilution of Trypsin in PBS. Due to its protease activities, trypsin solutions are widely used for cell dissociation, routine cell culture...
Gönderen 17,53 € *
0.5% Trypsin in PBS with 0.2% EDTA - 10X solution 0.5% Trypsin in PBS with 0.2% EDTA - 10X solution
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.5% Trypsin is produced by dilution of Trypsin in PBS. Due to its protease activities, trypsin solutions are widely used for cell dissociation, routine cell culture...
Gönderen 18,61 € *
TE buffer (1X) / Tris-EDTA buffer - pH7.5 TE buffer (1X) / Tris-EDTA buffer - pH7.5
Tris-EDTA buffer 1X concentrated, Buffer Grade. pH7.5 +/- 0.2. TE buffer is used in the formulation of buffer solutions in the pH range between 7.5 and 8.5. They are widely used in cell and molecular biology for processes such as protein...
Gönderen 38,50 € *
TE buffer (1X) Molecular Biology grade - pH8.0 TE buffer (1X) Molecular Biology grade - pH8.0
Tris-EDTA buffer 1X concentrated, molecular biology grade. pH8.0 +/- 0.2. TE buffer is used in the formulation of buffer solutions in the pH range between 7.5 and 8.5. They are widely used in cell and molecular biology for processes such...
Gönderen 0,53 € *
1-Thio-ß-D-glucose sodium salt dihydrate 1-Thio-ß-D-glucose sodium salt dihydrate
Purity: >99% (HPLC). CAS: [10593-29-0] - C6H11NaO5S x 2 H2O
Gönderen 120,97 € *
İpucu!
1,4mm Beads G2 DNA/RNA Extraction-Enhancer GENAXXON bioscience 1.4mm Beads of G2 DNA/RNA Extraction Enhancer
G2 DNA/RNA Enhancer for improved DNA/RNA extraction! The G2 DNA/RNA Enhancer is developed to increase the yield of microbial DNA during DNA extraction from difficult matrices for example clay and soil samples. The primary function of G2...
Gönderen 125,00 € *
10 x 25 Cryo tubes 5.0 mL (sterile) 10 x 25 Cryo tubes 5.0 mL (sterile)
Sterile 5mL Cryo tubes specially designed for the storage of biological material (cells, blood, serum, and other biological specimens) down to -196°C (liquid nitrogen) to ensure a tight, leakproof seal even at lowest temperatures. All...
104,96 € *
PBS solution without NaHCO3 (10X) PBS solution without NaHCO3 (10X)
PBS-solution with Ca and Mg and without NaHCO3. 10-times concentrated. Phosphate-buffered saline (PBS) is a balanced salt solution that is used for a variety of cell culture applications, such as washing cells before dissociation,...
19,98 € *
PBS solution without Mg, Ca, NaHCO3 (10X) PBS solution without Mg, Ca, NaHCO3 (10X)
PBS-solution without Ca and Mg and NaHCO3. 10-times concentrated. Phosphate-buffered saline (PBS) is a balanced salt solution that is used for a variety of cell culture applications, such as washing cells before dissociation,...
17,88 € *
10X Phosphate buffered saline powder (pH7.4) - 5 bags 10X Phosphate buffered saline powder (pH7.4) -...
Among biological buffers PBS is one of the most commonly used. The buffer is isotonic and non-toxic to cells and has the ability to maintain their osmolarity. Thereby the buffer is suitable for washing procedures in cell cultures and for...
104,00 € *
Custom made 10X PCR Buffer Custom made 10X PCR Buffer
Custom made 10X PCR Buffer or other buffer solutions. Price is valid for common buffers containing MgCl2, KCl, Tris-HCl, gelatine, Tween 20. Buffer will be delivered in 250mL glas bottles, but we can also offer other bottle sizes. Buffer...
Gönderen 192,95 € *
TBE buffer (10X) ready-to-use solution TBE buffer (10X) ready-to-use solution
This buffer is the most widely used buffer for electrophoresis on agarose or acrylamide gels, it is particularly well suited for high-voltage long migration conditions. pH8.3 +/- 0.2. Delivery in PE bottles / canister.
Gönderen 42,32 € *
TBE buffer ready-to-use TBE buffer (10X) ready-to-use solution (MB-Grade)
This buffer is the most widely used buffer for electrophoresis on agarose or acrylamide gels, it is particularly well suited for high-voltage long migration conditions. pH8.3 +/- 0.2.
Gönderen 45,60 € *
10X Tris buffered saline (pH8.0) - 10 bags 10X Tris buffered saline (pH8.0) - 10 bags
Contents of 1 pouch dissolved in deionized water and made up to 1000mL yields: 0.5M Tris buffered saline, 1.38M NaCl, 0.027M KCl, pH8.0 at 25°C.
478,62 € *
10X Tris-Borate-EDTA buffer (pH8.3) - 10 bags 10X Tris-Borate-EDTA buffer (pH8.3) - 10 bags
Contents of 1 pouch dissolved in deionized water and made up to 1000mL yields: 0.89M Tris-borate, 0.02M EDTA, pH8.3 at 25°C. In molecular biology, TBE and TAE buffers are used for agarose and polyacrylamide gel electrophoresis.TBE buffer...
346,90 € *
10X Tris-EDTA buffer (pH7.4) - 10 bags 10X Tris-EDTA buffer (pH7.4) - 10 bags
10 bags of a 10-fold Tris-EDTA buffer (pH7.4) - ready-to-use Tris/HCl-EDTA powder mixture for 1L ready-to-use buffer solution of pH7.4. This TE buffer is composed by Tris, a buffering agent and EDTA. EDTA has the ability to prevent...
189,26 € *
İpucu!
100-place polypropylene storage box with fixed lid (10x10) 100-place polypropylene storage box with fixed...
100-place polypropylene storage box with fixed lid, and 10x10 dividers for tubes up to 13mm in diameter, eg. 1.5 / 2.0mL microcentrifuge tubes or screw cap microtubes. Hinged, lockable lid with positioning lugs for stable stacking. Can...
4,49 € * 14,96 € *
10X PCR Buffer E complete 10X PCR Buffer E complete
1.0mL PCR buffer with MgCl2 and with (NH4)2SO4 for efficient DNA amplification. Standard buffer for the Genaxxon Taq DNA Polymerase E, and HotStart Taq DNA Polymerase. Please have also a look on our dNTP-Sets (100mM each dNTP) > or dNTP...
5,00 € *
10X PCR Buffer E incomplete 10X PCR Buffer E incomplete
1.0mL PCR buffer without MgCl2 but with (NH4)2SO4 for efficient DNA amplification. Standardbuffer for the Genaxxon Taq DNA Polymerase E, and HotStart Taq DNA Polymerase.
5,00 € *
10X PCR Buffer S complete 10X PCR Buffer S complete
1.0mL PCR buffer with MgCl2 but without (NH4)2SO4 for specific DNA amplification.
5,00 € *
10X PCR Buffer S incomplete 10X PCR Buffer S incomplete
1.0mL PCR buffer without MgCl2 and without (NH)4SO4 for specific DNA amplification.
5,00 € *
1mL 25mM MgCl2 solution for PCR 1mL 25mM MgCl2 solution for PCR
1.0mL of a 25mM MgCl2 solution for PCR. Can be used for optimization of PCR reactions. Other volumes or concentrations on request. Please have also a look on our dNTP-Sets (100mM each dNTP) > or dNTP mixes with 2mM > or 10mM >...
3,75 € *
2-(4-Aminophenyl)-6-methylbenzothiazole-7-sulfonic acid 2-(4-Aminophenyl)-6-methylbenzothiazole-7-sulfo...
Derivatization (fluorescent) reagent for the HPLC determination of aliphatic thiols.
Gönderen 157,22 € *
2-Anthracenylsulfonyl chloride 2-Anthracenylsulfonyl chloride
2-Anthracenylsulfonyl chloride
177,58 € *
2.5% Trypsin in PBS (10X) 2.5% Trypsin in PBS (10X)
Trypsin is a mixture of proteases isolated from porcine pancreas. 2.5% Trypsin is produced by dilution of Trypsin in PBS. Due to its protease activities, trypsin solutions are widely used for cell dissociation, routine cell culture...
Gönderen 23,01 € *
ddATP 2',3'- Dideoxyadenosine-5'-O-triphosphate (ddATP)
2',3'-Dideoxyadenosine-5'-O-triphosphate (ddATP) sodium salt of purity >95% HPLC. For other salt forms or a guaranteed higher purity please inquire. 2',3'-Dideoxyadenosine-5'-Triphosphate (ddATP) is a modified nucleoside triphosphate,...
Gönderen 283,30 € *
ddGTP 2',3'- Dideoxyguanosine-5'-O-triphosphate (ddGTP)
2',3'-Dideoxyguanosine-5'-O-triphosphate (ddGTP) sodium salt of purity >95% HPLC. For other salt forms or a guaranteed higher purity please inquire. 2',3'-Dideoxyguanosine-5'-triphosphate (ddGTP) is a modified nucleoside triphosphate,...
Gönderen 283,30 € *
ddCTP 2',3'- Dideoxycytidine-5'-O-triphosphate (ddCTP)
2',3'-Dideoxycytidine-5'-O-triphosphate (ddCTP) sodium salt of purity >95% HPLC. For other salt forms or a guaranteed higher purity please inquire. 2',3'-Dideoxycytidine-5'-Triphosphate (ddCTP) is a modified nucleoside triphosphate,...
Gönderen 283,30 € *
dTTP - ddTTP 2',3'-Dideoxythymidine-5'-O-triphosphate...
3'-Deoxythymidine-5'-O-triphosphate (2',3'-Dideoxythymidine-5'-O-triphosphate) (dTTP/ddTTP) sodium salt of purity >95% HPLC. For other salt forms or a guaranteed higher purity please inquire. Note: Since “thymidine“ already describes a...
Gönderen 294,34 € *
2',7'-Dichlorofluorescein 2',7'-Dichlorofluorescein
2',7'-Dichlorofluorescein is a fluorescent dye. Spectral data: Extinction 504nm/Emmission 529nm, in 0.1 M Tris pH 8.0. It is used for the determination of carbohydrates by fluorescence densitometry after TLC, in the determination of H2O2...
Gönderen 161,52 € *
200 mM L-glutamine (100 X) 200 mM L-glutamine (100 X)
200mM L-glutamine solution (100-times). L-Glutamine is an amino acid that is essential for cell culture. L-Glutamine is used in the formation of purine and pyrimidine nucleotides, amino sugars, glutathione, L-glutamate, and other amino...
Gönderen 17,70 € *
3-(4,6-Difluorotriazinyl)amino-7-methoxycoumarin / FAMC 3-(4,6-Difluorotriazinyl)amino-7-methoxycoumari...
3-(4,6-Difluorotriazinyl)amino-7-methoxycoumarin is used as a polarity fluorescence probe.
Gönderen 246,97 € *
3,3'5,5'-Tetramethylbenzidine (TMB) 3,3'5,5'-Tetramethylbenzidine (TMB)
Substrate for horseradish peroxidase detection assays.
Gönderen 154,09 € *
3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK 3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK
The DYKDDDDK peptide was developed specifically for immunoaffinity chromatography. The peptide allows the competitive elution of proteins (amino terminal, metaminoterminal or carboxy-terminal) FLAG® fusion proteins from anti-FLAG M1 or...
Gönderen 238,96 € * 298,70 € *
Dabcyl-IAA 4-{[4-(Dimethylamino)-phenyl]-azo}-benzoic...
4-[[4-(Dimethylamino)-phenyl]azo]-benzoesäure-[3-(iodacetamido)- propyl]-amide is a non-fluorescent FRET quencher. It readily reacts with the thiol group found on cysteine or with thiol-modified oligonucleotides to form a stable...
Gönderen 90,35 € *
BMC, Br-MMC - 5 mg BMC, Br-MMC - 5 mg
4-Bromomethyl-7-methoxycoumarin
353,28 € *
4-Chloro-1-Naphthol 4-Chloro-1-Naphthol (min. 99.0% HPLC)
4-Chloro-1-naphtol is peroxidase substrate suitable for use in immunoblotting. The endproduct of the enzymatic reaction is an insoluble blue precipitate that can be observed visually. The precipitate can is not removed by washing with...
Gönderen 96,83 € *
4-Di-2-ASP 4-Di-2-ASP
4-(4-Diethylaminostyryl)-1-methylpyridinium iodide (4-Di-2-ASP). Some cationic mitochondrial dyes such as 4­Di­1­ASP and 4­Di­2­ASP stain presynaptic nerve terminals independent of neuronal activity. The photostable 4­Di­2­ASP dye, which...
131,80 € *
4-Nitrophenyl a-L-fucopyranoside - min. 99% 4-Nitrophenyl a-L-fucopyranoside - min. 99%
pNPh-a-L-Fuc, CAS: [22153-71-5] - C12H15NO7
Gönderen 208,39 € *
4-Nitrophenyl a-D-manopyranoside - min. 99% 4-Nitrophenyl a-D-manopyranoside - min. 99%
pNPh-a-D-Man, CAS: [10357-27-4] - C12H15NO8
Gönderen 291,78 € *
4-Nitrophenyl b-D-xylopyranoside - min. 99% 4-Nitrophenyl b-D-xylopyranoside - min. 99%
pNPh-b-D-Xyl - CAS: [2001-96-9] - C11H13NO7
Gönderen 175,07 € *
4-Nitrophenyl-2-acetamido-2-deoxy-b-D-glucopyranoside (min. 99.0% HPLC) 4-Nitrophenyl-2-acetamido-2-deoxy-b-D-glucopyra...
pNPh-b-D-GlcNAc - CAS: [3459-18-5] - C14H18N2O8
Gönderen 183,01 € *
4,5-Diaminofluorescein - DAF-2 4,5-Diaminofluorescein - DAF-2
DAF-2 (4,5-Diaminofluorescein) shows higher photostability than the classical fluorescein derivative DAF. Applications: DAF-2 is highly sensitive reagent for NO detection and determination of nitric oxide synthase activity. DAF-2,...
Gönderen 268,17 € *
4,5-Diaminofluoresceindiacetat - DAF-2 DA 4,5-diaminofluorescein diacetate - DAF-2 DA
4,5-diaminofluorescein diacetate (DAF-2 DA) is a highly sensitive probe for the real time detection of NO in vivo. Cell permeable. Application: DAF-2 DA is probably the most successful indicator for nitric oxide. As with other...
Gönderen 292,16 € *
4,5-Diaminofluorescein triazole - DAF-2T 4,5-Diaminofluorescein triazole - DAF-2T
4,5-Diaminofluorescein triazole (DAF-2T) can be used as a reference material for DAF-2 ( S5439 > ). References: (1) M. Feelisch et al;, Free Radical Biol. Med. 38(3), 356 (2005); (2) T. Nagano et al.; J. Biol. Chem. 277(1), 47 (2002);...
Gönderen 263,11 € *
40 x 25 Cryo tubes 1.2mL (sterile) 40 x 25 Cryo tubes 1.2mL (sterile)
Sterile 1.2mL Cryo tubes specially designed for the storage of biological material (cells, blood, serum, and other biological specimens) down to -196°C (liquid nitrogen) to ensure a tight, leakproof seal even at lowest temperatures. All...
178,26 € *
40 x 25 Cryo tubes 2.0 mL (sterile) 40 x 25 Cryo tubes 2.0 mL (sterile)
Sterile 2mL Cryo tubes specially designed for the storage of biological material (cells, blood, serum, and other biological specimens) down to -196°C (liquid nitrogen) to ensure a tight, leakproof seal even at lowest temperatures. All...
340,94 € *
5-Aminofluorescein 5-Aminofluorescein
Description: The uronic acid residues of all known glycosaminoglycuronans react wit 5-aminofluorescein to yield fluorescent derivatives, which show fluorescence characteristics identical to those of 5-acetamidofluorescein....
Gönderen 65,17 € *
5-Carboxyfluorescein diacetate N-succinimidyl ester / 5-FAM DA SE 5-Carboxyfluorescein diacetate N-succinimidyl...
5-CFDA is membrane-permeant and thus can be loaded into cells via incubation. Once inside the cells, 6-CFDA is hydrolyzed by intracellular esterases to 6-carboxyfluorescein. Reagent for continuously determining the intracellular pH in...
Gönderen 134,83 € *
5-Carboxyfluorescein succinimidyl ester / 5-FAM-SE 5-Carboxyfluorescein succinimidyl ester / 5-FAM-SE
5-Carboxyfluoresceinsuccinimidylester. Amine-reactive fluorescein dye marker for fluorescence labeling, especially for labeling of biomolecules (Abs: 495 nm, Em: 519 nm). This single isomer amine-reactive derivatization reagent may be...
Gönderen 112,90 € *
5X TBE buffer (pH8.3) - 10 bags 5X TBE buffer (pH8.3) - 10 bags
Contents of 1 pouch dissolved in deionized water and made up to 1000mL yields: 0.445M Tris-borate, 0.01M EDTA, pH8.3 at 25°C. In molecular biology, TBE and TAE buffers are used for agarose and polyacrylamide gel electrophoresis. TBE...
245,00 € *
5-FAM DA 5-FAM DA
5-Carboxyfluorescein diacetate. Carboxyfluorescein diacetate (CFDA), which was originally used to measure intracellular pH but was soon adapted for use as a cell viability indicator. Upon hydrolysis by intracellular nonspecific...
262,76 € *
5-FAM single isomer 5-FAM, single isomer
The single isomer 5-FAM (6-Carboxyfluorescein) is an amine-reactive derivative of Fluorescein > giving stable derivatives upon conjµgation with biopolymers. The amine-reactive fluorescein derivatives 5-FAM > and 6-FAM > and the mixed...
Gönderen 58,82 € *
5-JOE 5-JOE single isomer
5-Carboxy-4',5'-dichloro-2',7'-dimethoxyfluorescein and other fluoreszence dyes. Genaxxon bioscience offers a broad range of different fluorscence dyes for labelling probes or for other research purposes. This non-activated fluorescein...
228,56 € *
5-Maleimido-eosin 5-Maleimido-eosin
5-maleimido-eosin is a good photosensitizer and can be used to selectively label thiols. It has a quantum yield of 0.57 for singlet oxygen generation, which makes it useful for photoconversion of electron-rich materials such as...
Gönderen 243,34 € *
5-ROX - 5-Carboxy-X-rhodamine single isomer 5-ROX, single isomer
5-ROX (5-carboxy-X-rhodamine) is a derivative of the amine-reactive carboxy-X-rhodamine (ROX). Compared to the fluoresceine family of dyes, Rhodamine dyes are more resistant to photo bleaching and stable over a wider pH range. The...
Gönderen 231,48 € *
5-TAMRA 5-TAMRA (5-carboxytetramethylrhodamine) -...
5-TAMRA is the pure 5-isomer of carboxytetramethylrhodamine (TMR) free acid. The non-activated single isomer carboxytetramethyl rhodamine derivative is used as a red fluorescent derivatization reagent for covalently labeling proteins and...
Gönderen 221,37 € *
5-TAMRA-DMTr-phosphoramidite 5-TAMRA-DMTr-phosphoramidite
5-Carboxytetramethylrhodamine DMTr-CE-phosphoramidite (TAMRA-phosphoramidite) for automated 5'- and 3'-labeling of oligonucleotides (Abs: 549 nm, Em: 572 nm). Single isomer TAMRA phosphoramidite derivatives are used as highly convenient...
484,80 € *
5-TAMRA-SE / 5-Carboxytetramethylrhodamine N-succinimidyl ester 5-TAMRA-SE / 5-Carboxytetramethylrhodamine...
Amine-reactive carboxytetramethylrhodamine is one of the most commonly used red fluorescent dye marker for fluorescence labeling, especially for labeling of biomolecules (Abs: 554 nm, Em: 577 nm). This single isomer amine-reactive red...
Gönderen 338,71 € *
5(6) Carboxy-X-rhodaminsuccinimidylester / 5(6) ROX SE 5(6) Carboxy-X-rhodaminsuccinimidylester / 5(6)...
5'/6'-Carboxy-X-rhodaminsuccinimidylester. Amine-reactive rhodamine dye marker for fluorescence labeling, especially for labeling of biomolecules (Abs: 584 nm, Em: 599 nm). The amine-reactive derivative of X-Rhodamine has a long-wave...
Gönderen 145,00 € *
5/6 FAM SE - carboxyfluorescein succinimidylester 5(6) Carboxyfluorescein succinimidyl ester /...
Amine-reactive fluorescein dye marker for labeling of biomolecules (Abs: 496 nm, Em: 517 nm). This amine-reactive fluorescein derivatization reagent is widely used for covalent labeling of proteins and alkylamino modified nucleic acids....
Gönderen 135,00 € *
5/6-Carboxytetramethylrhodamine NHS ester 5(6) TAMRA-SE / 5(6)...
5(6)-Carboxytetramethylrhodamine succinimidyl ester (5(6) TAMRA-SE) is an amine-reactive rhodamine dye marker for fluorescence labeling, especially for labeling of biomolecules (Abs: 554 nm, Em: 577 nm). This amine-reactive red...
Gönderen 177,84 € *
5(6)-Carboxy-2',7'-dichlorofluorescein diacetate N-succinimidyl ester / 5(6)-Carboxy-DCF DA SE 5(6)-Carboxy-2',7'-dichlorofluorescein...
5-(and-6)-Carboxy-2',7'-dichlorofluorescein diacetate, succinimidyl ester is a useful fluorescent tracer that can passively diffuse into cells and covalently label intracellular proteins, resulting in long-term cell labeling. The reagent...
Gönderen 266,97 € *
5(6)-Carboxy-2',7'-dichlorofluorescein diacetate NHS-Ester (DCFDA NHS ester) 5(6)-Carboxy-2',7'-dichlorofluorescein...
5(6)-Carboxy-2',7'-dichlorofluorescein diacetate, succinimidyl ester (DCFDA NHS ester) is a useful fluorescent tracer that can passively diffuse into cells and covalently label intracellular proteins, resulting in long-term cell...
Gönderen 365,27 € *
5(6)-CFDA N-succinimidyl ester / 5(6)-FAM DA SE 5(6)-CFDA N-succinimidyl ester / 5(6)-FAM DA SE
5(6)-Carboxyfluorescein diacetate N-succinimidyl ester is a useful fluorescent tracer that can passivley diffuse into cells and covalently label intracellular proteins, resulting in long-term cell labeling. The reagent itself is...
Gönderen 175,94 € *
5/6-FAM / 5(6) FAM 5/6 FAM mixed isomers
The mixed isomers 5/6-FAM (5/6-Carboxyfluorescein) is an amine-reactive derivative of Fluorescein > giving stable derivatives upon conjµgation with biopolymers. The amine-reactive fluorescein derivatives 5-FAM > and 6-FAM > and the mixed...
Gönderen 58,82 € *
5(6)-FITC - 5(6)-Fluorescein-isothiocyanate 5/6 FITC / Fluorescein 5(6)-isothiocyanate
Fluorescein 5/6-isothiocyanate mixture of 5 and 6 Fluorescein-isothiocyanate. Reagent for the FITC labeling of proteins, Microsequencing of proteins and peptides (HPLC). Biological applications include use as a fluorescent labeling...
Gönderen 83,19 € *
5/6-FAM DA 5/6-FAM DA
5(6)-Carboxyfluorescein diacetate
182,22 € *
5/6-JOE 5/6-JOE mixed isomer
5/6-Carboxy-4',5'-dichloro-2',7'-dimethoxyfluorescein and other fluoreszence dyes. Genaxxon bioscience offers a broad range of different fluorscence dyes for labelling probes or for other research purposes. This non-activated fluorescein...
209,51 € *
5/6-ROX mixed isomers 5/6-ROX, mixed isomers
5/6-ROX (5/6-carboxy-X-rhodamine) is a derivative of the amine-reactive carboxy-X-rhodamine (ROX). Compared to the fluoresceine family of dyes, Rhodamine dyes are more resistant to photo bleaching and stable over a wider pH range. The...
Gönderen 259,96 € *
5/6 TAMRA 5/6-TAMRA (5/6-carboxytetramethylrhodamine) -...
5/6-TAMRA is a mixtures of the 5' and 6' isomers of carboxytetramethylrhodamine (TMR) free acid. The non-activated single isomer carboxytetramethyl rhodamine derivative is used as a red fluorescent derivatization reagent for covalently...
Gönderen 221,37 € *
5% SDS solution 5% SDS Solution
5% SDS solution as cleansing solution for lenses of optical systems like lathe from EOS GmbH (Electro-Optical Systems). Filtered and ready-to-use. SDS may precipitate at temperature below 15°C. Dissolve precipitated SDS by warming up in...
Gönderen 14,07 € *
50X Tris-Acetate-EDTA buffer (pH8.3 - 5 bags) 50X Tris-Acetate-EDTA buffer (pH8.3 - 5 bags)
Contents of 1 pouch dissolved in deionized water and made up to 500mL/1000mL yields: 2.0M Tris acetate buffer, 0.05M EDTA, pH8.3 at 25°C. In molecular biology, TBE > and TAE buffers are used for agarose and polyacrylamide gel...
Gönderen 340,20 € *
5X PCR Buffer Red 5X PCR Buffer Red
5X PCR Buffer Red is a ready to use PCR buffer, including all components for standard PCR applications. FEATURES All in one buffer for highest convenience Direct gel loading onto agarose gels Red colour enables easy visualisation of...
14,50 € *
5X qPCR Multiplex MasterMix 5X qPCR Multiplex MasterMix
5X Multiplex PCR Mastermix for robust PCR with all components for rapid, sensitive and reproducible quantification of DNA. The optimized DNA polymerase and an optimized buffer including our ultrapure dNTPs are key components of the ready...
Gönderen 25,00 € *
6-(7-Nitrobenzofurazan-4-ylamino)-hexanoic acid / NBD-X 6-(7-Nitrobenzofurazan-4-ylamino)-hexanoic acid...
Fluorescent probe used for investigation of binding sites of fatty acid and sterol carrier proteins, also used for cell membrane staining.
Gönderen 186,73 € *
6-Aminofluorescein 6-Aminofluorescein
Fluoresceinamine Isomer II. Glycosaminoglycuronans react with 6-aminofluorescein to yield fluorescent derivatives.
353,57 € *
6-Aminoquinoline N-succinimidyl ester / AQC 6-Aminoquinoline N-succinimidyl ester / AQC
6-Aminoquinoline N-succinimidyl ester may be used for covalent labeling of proteins and peptides. Suitable for amino acid or protein sequence analysis by HPLC with fluorescence detection. Applications:...
Gönderen 512,01 € *
6-Carboxy-X-rhodamine-N-succinimidyl ester / 6-ROX-SE 6-Carboxy-X-rhodamine-N-succinimidyl ester /...
Amine-reactive carboxy-X-rhodamine dye marker for fluorescence labeling, especially for labeling of biomolecules (Abs: 584 nm, Em: 599 nm). The amine-reactive derivative of carboxy-X-rhodamine has a long-wave fluorescence emission and is...
Gönderen 262,44 € *
6-Carboxyfluorescein diacetate N-succinimidyl ester / 6-FAM DA SE 6-Carboxyfluorescein diacetate N-succinimidyl...
6-CFDA is membrane-permeant and thus can be loaded into cells via incubation. Once inside the cells, 6-CFDA is hydrolyzed by intracellular esterases to 6-carboxyfluorescein. Reagent for continuously determining the intracellular pH in...
Gönderen 134,83 € *
6-Carboxytetramethylrhodamine-N-succinimidylester / 6-TAMRA-SE 6-Carboxytetramethylrhodamine-N-succinimidylest...
Amine-reactive carboxytetramethylrhodamine is one of the most commonly used red fluorescent dye marker for fluorescence labeling, especially for labeling of biomolecules (Abs: 554 nm, Em: 577 nm). This single isomer amine-reactive red...
Gönderen 244,42 € *
6-FAM single isomer 6-FAM, 6-Carboxyfluorescein - single isomer
The single isomer 6-FAM (6-Carboxyfluorescein) is an amine-reactive derivative of Fluorescein > giving stable derivatives upon conjugation with biopolymers. The single amine-reactive fluorescein derivatives 5-FAM > and 6-FAM > and the...
Gönderen 125,00 € *
6-FAM DA 6-FAM DA
6-Carboxyfluorescein diacetate. Used to differentiate viable cells from apoptotic cells. Live cells that are not apoptotic accumulate 6-carboxyfluorescein but do not accumulate annexin.
269,54 € *
6-FAM / 6-FAM N-succinimidyl ester 6-FAM-SE / 6-Carboxyfluorescein succinimidyl ester
6-FAM is a popular green fluorescent cell-permeable dye. Due to the covalent coupling reaction of 6-FAM-SE, 6-FAM can be retained within cells for extremely long periods and due to this stable linkage, once incorporated within cells the...
Gönderen 111,44 € *
6-JOE 6-JOE single isomer
6-JOE (6-Carboxy-4',5'-dichloro-2',7'-dimethoxyfluorescein) and other fluoreszence dyes. Genaxxon bioscience offers a broad range of different fluorscence dyes for labelling probes or for other research purposes. This non-activated...
228,56 € *
6-ROX 6-ROX, single isomer
6-ROX (6-carboxy-X-rhodamine) is a derivative of the amine-reactive carboxy-X-rhodamine (ROX). Compared to the fluoresceine family of dyes, Rhodamine dyes are more resistant to photo bleaching and stable over a wider pH range. The...
Gönderen 287,67 € *
6-TAMRA, single isomer 6-TAMRA, single isomer
6-TAMRA is the pure 6-isomer of carboxytetramethylrhodamine (TMR) free acid. The non-activated single isomer carboxytetramethyl rhodamine derivative is used as a red fluorescent derivatization reagent for covalently labeling proteins and...
Gönderen 297,27 € *
6-TAMRA-DMTr-phosphoramidite 6-TAMRA-DMTr-phosphoramidite
6-Carboxytetramethylrhodamine DMTr-CE-phosphoramidite (TAMRA-phosphoramidite) for automated 5'- and 3'-labeling of oligonucleotides (Abs: 549 nm, Em: 572 nm). Single isomer TAMRA phosphoramidite derivatives are used as highly convenient...
484,80 € *
6,7-Diethoxy-4-trifluoromethylcoumarin - 50 mg 6,7-Diethoxy-4-trifluoromethylcoumarin - 50 mg
6,7-Diethoxy-4-trifluoromethylcoumarin
618,11 € *
7-Acetoxy-1-methyl-quinolinium iodide 7-Acetoxy-1-methyl-quinolinium iodide
7-Acetoxy-1-methyl-quinolinium iodide
726,52 € *
7-Diethylaminocoumarin-3-carboxylic acid / DEAC 7-Diethylaminocoumarin-3-carboxylic acid / DEAC
DEAC, acid is a useful blue fluorescent building block for labeling amine-containing biomolecules. 7-(Diethylamino)-coumarin-3-carboxylic acid is a reagent for the derivatisation of amines and proteins. It has also been used for...
Gönderen 126,50 € *
7-Methoxy-4-trifluoromethylcoumarin - 100 mg 7-Methoxy-4-trifluoromethylcoumarin - 100 mg
7-Methoxy-4-trifluoromethylcoumarin
376,71 € *
PCR cap strips for realtime PCR 8-cap sealing strips, 300 strips
PCR cap strips (8 caps per strip) for sealing 96-well PCR plates or PCR tube strips. Strips can be removed after PCR and replaced without problems. Flat cap strips are ideal for fluorescence detection in real-time PCR.
124,54 € *
Strips of 8 PCR Tubes with tethered Caps 8 PCR Tube Strips (0.1 and 0.2mL)
Obtain optimal heat transfer with these 0.1mL low-profile or 0.2mL standard PCR 8-tube strips, with individually attached caps (optically clear flat caps) which are made from 100% pure polypropylene. Low Profile PCR tube strips are...
150,49 € *
9-Anthracenecarbaldehyde 9-Anthracenecarbaldehyde
Fluorescent reagents (probe, stain, label) with reactive functional group for chromatography or spectroscopy. Derivatization agent. Used for membrane research, luminescent detection, molecular biology, protein modifications, protein...
Gönderen 78,31 € *
9,10-Anthracenediyl-bis(methylene)dimalonic acid 9,10-Anthracenediyl-bis(methylene)dimalonic acid
9,10-Anthracenediyl-bis(methylene)dimalonic acid. Reagent for the assay of O2. This substance shows a better characteristic than 9,10-anthracenediyl-bis-dipropionic acid.
Gönderen 108,43 € *
GENAXXON bioscience 96-well PCR plates, semi skirted, white 96-well PCR plates, semi skirted, white
Half skirted, rigid 96-well plates. Thin walled for optimal heat transfer producing maximal PCR results. Designed for 0.2mL Thermal Cyclers. Flat and rigid upper plate. Sealing by film or caps, Fully certified for PCR use. With black...
110,46 € * 184,10 € *
non-skirted, low-profile (0.1mL) PCR plate 96-well PCR plates, non-skirted, white wells
Non-skirted, 96-well plates. Thin walled for optimal heat transfer producing maximal PCR results. Designed for 0.1mL Thermal Cyclers. Flat and rigid upper plate. Sealing by film or caps, Fully certified for PCR use. With white printed...
Gönderen 175,20 € *
96-well PCR Plates - non-skirted with black coding 96-well PCR Plates - non-skirted with black coding
Standard 96-well PCR plates without frame can be used in all standard thermal cyclers with a 0.2mL block. Transparent plate with black coding (A-H; 1-12). Special features: Optimal heat transfer through low and uniform wall thicknesses....
Gönderen 151,84 € *
96-well qPCR plate for LC480 from Roche 96-well semi-skirted low profile LC480 PCR plates
Standard half skirted, low profile, 96-well PCR plate for Roche LC480. Thin walled for optimal heat transfer producing maximal PCR results. Sealing by film or caps, Fully certified for PCR use. These plates can also be used in an ABi...
Gönderen 183,00 € *
a-D-Galactopyranose-phosphate di-potassium salt dihydrate (min. 99.0% HPLC) a-D-Galactopyranose-phosphate di-potassium salt...
a-D-Galactose-1-phosphate dipotassium salt dihydrate (synthetic crystalline product). Free carbonate and phosphate are completely removed. a-D-Galactose-1-phosphate. Product shipped with certificate covering all data for validation (NMR,...
Gönderen 202,60 € *
a-D-Glucopyranose-phosphate di-potassium salt dihydrate (min. 99.0% HPLC) a-D-Glucopyranose-phosphate di-potassium salt...
a-D-Glucose-1-phosphate dipotassium salt dihydrate, Cori-Ester di-K (synthetic crystalline product). a-D-Glucopyranose-phosphate. Free carbonate and phosphate are completely removed. Product shipped with certificate covering all data for...
Gönderen 61,85 € *
a-D-Mannose-1-phosphate a-D-Mannopyranose-phosphate di-potassium salt...
a-D-Mannose-1-phosphate dipotassium salt dihydrate (synthetic crystalline product). a-D-Mannopyranose-phosphate. Free carbonate and phosphate are completely removed. Product shipped with certificate covering all data for validation (NMR,...
Gönderen 344,00 € *
Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR
Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically,...
238,00 € *
Ac-KLVFF-NH2 Ac-KLVFF-NH2
Ac-KLVFF-NH2 is the N-terminal and C-terminal modified form of the amyloid-beta (16-20) inhibitor peptid KLVFF. The modification leads to higher stability against peptidases. The KLVFF peptide is one of several inhibitors of amyloid-beta...
Gönderen 158,70 € *
Accutase® Cell Detachment Solution Accutase® Cell Detachment Solution
Accutase® as a cell detachment solution of proteolytic and collagenolytic enzymes useful for the routine detachment of cells from standard tissue culture plastic ware and adhesion coated plastic ware. The reagent is useful for creating...
74,62 € *
Acetyl-Coenzym A Acetyl Coenzyme A (>83% enzymatic)
Acetyl Coenzyme A (Ac CoA) is the end product of glycolysis and takes part in the Ac CoA pathway, which is a metabolic pathway for carbon compounds. Ac-CoA is important in cholesterol synthesis. Fatty acids are relatively unreactive and...
Gönderen 140,00 € *
ACTH (1-10), human SYSMEHFRWG ACTH (1-10), human SYSMEHFRWG
ACTH (1-10), human SYSMEHFRWG is a synthetic peptide according to the first 10 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates...
Gönderen 72,00 € * 90,00 € *
ACTH (1-16), human SYSMEHFRWGKPVGKK ACTH (1-16), human SYSMEHFRWGKPVGKK
ACTH (1-16), human SYSMEHFRWGKPVGKK is a synthetic peptide according to the first 16 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it...
238,00 € *
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39), human...
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the first 39 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex....
Gönderen 441,75 € * 465,00 € *
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the amino acids 18 to 39 of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically,...
Gönderen 261,25 € * 275,00 € *
ACTH (4-10), human MEHFRWG ACTH (4-10), human MEHFRWG
ACTH (4-10), human MEHFRWG is a synthetic peptide according to the amino acids 4 to 10 of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates...
Gönderen 85,50 € * 90,00 € *
Adenosin Adenosine (>99%)
Synonym: Adenosin, Adenosine, 9-β-D-Ribofuranosyladenine, Adenine riboside, Adenine-9-β-D-ribofuranoside, D-Adenosine
Gönderen 49,55 € *
qPCR adhesive plate seals qPCR adhesive plate seals
The Genaxxon qPCR adhesive seals are made of a optically clear adhesive film, with a pressure activated clue. The film is peelable and thus perfectly suitable for qPCR and other imaging techniques including crystallization applications....
Gönderen 135,00 € *
PCR plate seal Adhesive Film - Low strength for 96-well plates
This transparent polyester-based film has a low strength adhesive. It is designed as a cost-effective plate sealing option for temporary storage or protection for applications such as centrifugation. The protruding ends allow easy...
46,35 € *
AEBSF Inhibitor chemical structure AEBSF Hydrochloride
AEBSF is an irreversible inhibitor of Thrombin and other Serin proteases (Chymotrypsin, Kallikrein, Plasmin, Proteinase K, Trypsin) by sulfonylation of a functional group in the active centre of the enzyme. AEBSF is much less toxic...
Gönderen 207,55 € *
empty midi spin column for affinity purification Empty Spin Columns 20 mL for Affinity...
Empty Spin Columns for standard protein purification procedures, e.g. affinity chromatography with Ni-IDA, Ni-NTA, Co-IDA oder Co-NTA agaroses. The smallest column size does have a capacity of 0.5mL (S) and are ideal for protein...
Gönderen 89,50 € *
Agarose LE from GENAXXON bioscience Agarose LE - Standard Agarose
Agarose LE is a standard agarose for the separation of DNA in the size range between 100bp and 25kbp. It is suitable for all analytical and preparative electrophoresis of nucleic acids in routine gel electrophoresis. Depending on the...
Gönderen 85,60 € *
Agarose LE tablets Agarose LE tablets
Agarose LE tablets of 0.5g each for separation of DNA in the size range between 100bp and 25kbp. Agarose LE is suitable for all analytical and preparative electrophoresis of nucleic acids in routine gel electrophoresis. Depending on the...
Gönderen 148,50 € *
Agarose LM - chemical structure Agarose LM - low melting
Agarose LM is the original low melting agarose. This "molecular biology grade" agarose gives gels with better properties and higher transparency than the standard normal melting point agarose. The agarose is equivalent to SeaPlaque™ from...
Gönderen 63,00 € *
Agarose Mega Agarose Mega
Agarose Mega resolved DNA and RNA fragments from >100bp up to 50kb. Due to the high gel strength the agarose is ideally suited for Southern- and Northern blotting experiments or Pulsed Field Gel Electrophoresis (PFGE) as gel will not...
Gönderen 79,77 € *
Low melting Agarose Tiny from Genaxxon - M3046 Agarose Tiny - low melting agarose
Agarose Tiny is a low melting temperature agarose. It is a molecular biology grade agarose with higher sieving properties and higher clarity than standard melting temperature agarose. Like the SeaPlaque ™ from Lonza, the Agarose Tiny has...
Gönderen 56,72 € * 85,08 € *
Agarose Tiny HT von Genaxxon Agarose Tiny HT high resolution, normal melting
Our Agarose Tiny HT is a high resolution (+/-2 bp), normal melting agarose for fine resolution of small DNA fragments in the 20 bp to 1500 bp range. It can be used for genotyping, allele sizing and short tandem repeat analysis. Agarose...
Gönderen 91,68 € *
Albumin from hen egg white - Ovalbumin Albumin from hen egg white - Ovalbumin
Albumin from hen egg white (ovalbumin) is a phosphorylated glycoprotein that contains 385 amino acid residues and has a molecular weight of 42.7 kDa. Chicken egg white is the protein component with the highest amount of egg white. It is...
Gönderen 226,29 € *
Alpha MEM Eagle with nucleosides, with glutamine, without glucose - 500 mL Alpha MEM Eagle with nucleosides, with...
MEM α (Minimum Essential Medium α) is widely used for mammalian cell culture as well as selection for transfected DHFR-negative cells. MEM α can be used with a variety of suspension and adherent mammalian cells, including keratinocytes,...
67,50 € *
Alpha MEM Eagle with nucleosides, with L-Glutamine, with Glucose Alpha MEM Eagle with nucleosides, with...
MEM α (Minimum Essential Medium α) is widely used for mammalian cell culture as well as selection for transfected DHFR-negative cells. MEM α can be used with a variety of suspension and adherent mammalian cells, including keratinocytes,...
55,57 € *
Alpha MEM Eagle with Nucleosides, with stable Gluamine Alpha MEM Eagle with Nucleosides, with stable...
Alpha MEM medium, with sodium bicarbonate, with stable glutamine, with ribonucleosides and deoxyribonucleosides, sterile-filtered, for cell culture applications. Alpha medium is a modified MEM medium, originally developed to grow Chinese...
32,14 € *
Alpha MEM Eagle with Nucleosides, without amino acids Alpha MEM Eagle with Nucleosides, without amino...
Alpha MEM Eagle medium, with Nucleosides, without Amino Acids, with Glucose, without Hepes, with 2.2g/L sodium bicarbonate, sterile-filtered, for cell culture applications. Special preparation. Minimal order size: 20 x 500mL. Alpha...
58,48 € *
Alpha MEM Eagle w/o Glutamine, w/o nucleosides Alpha MEM Eagle w/o Glutamine, w/o nucleosides
MEM α (Minimum Essential Medium α) is widely used for mammalian cell culture as well as selection for transfected DHFR-negative cells. MEM α can be used with a variety of suspension and adherent mammalian cells, including keratinocytes,...
62,32 € *
Alpha MEM Eagle w/o Nukleosides, w/o Arg, w/o Lys Alpha MEM Eagle w/o Nukleosides, w/o Arg, w/o Lys
Alpha MEM Eagle medium, without nucleoside, without Arginine, without Lysine, with Glucose, without Hepes, with Phenol red, with 2.2g/L sodium bicarbonate, sterile-filtered, for cell culture applications. Special preparation. Minimal...
64,06 € *
Alpha MEM Eagle with Nucleosides, with L-Gluamine, with Glucose Alpha MEM Eagle with Nucleosides, with...
Alpha MEM medium, with sodium bicarbonate, with L-Glutamine, with Glucose, with ribonucleosides and deoxyribonucleosides, sterile-filtered, for cell culture applications. Alpha medium is a modified MEM medium, originally developed to...
21,50 € *
Alpha MEM Eagle wo Nucleosides, with L-Gluamine, with Glucose Alpha MEM Eagle wo Nucleosides, with...
Alpha MEM medium, with sodium bicarbonate, with L-glutamine, with Glucose, without ribonucleosides and without deoxyribonucleosides, sterile-filtered, for cell culture applications. Alpha medium is a modified MEM medium, originally...
22,70 € *
alpha-Chymotrypsin (EC 3.4.21.1) alpha-Chymotrypsin (EC 3.4.21.1)
alpha-Chymotrypsin is a serine peptidase that hydrolyzes peptide bonds with aromatic or large hydrophobic side chains (Tyr, Trp, Phe, Leu) on the carboxyl end of the bond. Ca2+ activates and stabilizes the enzyme. The enzyme has 241...
Gönderen 69,08 € *
AMCA-H / 7-Amino-4-methyl-3-coumarinylacetic acid AMCA-H / 7-Amino-4-methyl-3-coumarinylacetic acid
AMCA is one of the brightest amine-reactive blue fluorescent dyes useful for immunofluorescence and fluorescent labeling (Ex/Em: 353/455nm). It is quite photostable, and its fluorescence is pH-independent from pH 4 to 10. The properties...
Gönderen 90,35 € *
Amoxicillin trihydrate Amoxicillin trihydrate
Amoxicillin is an inhibitor of bacterial cell wall synthesis. It inhibits the crosslinking of peptidoglycan by binding and inactivating transpeptidases. High acitivity against gram-negative bacteria like Agrobacterium species. Sensitive...
Gönderen 87,00 € *
Amphotericin B Solution from Genaxxon Amphotericin B solution
Amphotericin B is a polyene antifungal that is used in cell culture to suppress fungal and yeast contamination, but does not act on bacteria. Addition of deoxycholate in phosphate buffer improves water solubility. For use: dilute 1: 100...
Gönderen 28,46 € *
Amphotericin B - chemical structure Amphotericin B Powder
For tissue culture to prevent growth of yeasts and fungi. Amphotericin B is an antifungal and was isolated from Streptomyces nodosus . It is one of the macrocyclic lactones and its action is fungistatic . Amphotericin B binds to sterols...
Gönderen 59,85 € *
Ampliqon Taq Polymerase - A111103 Ampliqon Taq DNA Polymerase with Ammonium buffer
Ampliqon Taq DNA Polymerase is ideal for routine PCR applications where high yield and reliable DNA amplification are required. DESCRIPTION Ampliqon Taq DNA Polymerase exhibits both a 5'→3' DNA polymerase and a 5'→3 exonuclease activity....
Gönderen 65,00 € *
Ampliqon Taq DNA Polymerase with Standard buffer Ampliqon Taq DNA Polymerase with Standard buffer
Ampliqon Taq DNA Polymerase is ideal for routine PCR applications where high yield and reliable DNA amplification are required. DESCRIPTION Ampliqon Taq DNA Polymerase exhibits both a 5'→3' DNA polymerase and a 5'→3 exonuclease activity....
Gönderen 65,00 € *
Ampliqon Taq Polymerase Ampliqon Taq DNA Polymerase without Puffer
Ampliqon Taq DNA Polymerase is ideal for routine PCR applications where high yield and reliable DNA amplification are required. DESCRIPTION Ampliqon Taq DNA Polymerase exhibits both a 5'→3' DNA polymerase and a 5'→3 exonuclease activity....
Gönderen 65,00 € *
Amyloid-beta (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Amyloid-beta (1-42), rat...
[beta]-Amyloid (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques...
Gönderen 687,86 € * 724,07 € *
Amyloid-beta (16-20) KLVFF inhibitor peptide of Amyloid-beta Amyloid-beta (16-20) KLVFF inhibitor peptide of...
[beta]-Amyloid (16-20) - KLVFF (peptide sequence: KLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-40 peptide. The KLVFF peptide is one of several inhibitors of amyloid-beta aggregation that have...
100,26 € *
Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ
Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ. Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by...
Gönderen 218,04 € *
Antennapedia (43-58) penetratin Antennapedia (43-58) penetratin
Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable macromolecules, such as peptides, proteins, nucleic acids and nanoparticles. CPPs are usually...
Gönderen 200,00 € * 250,00 € *
Antibiotic Antimycotic Solution (100X) Antibiotic Antimycotic Solution (100X)
Antibiotic Antimycotic Solution (100X) for prevention of contamination by bacteria, yeasts and moulds. Penicillin G from Penicillium notatum and streptomycin from Streptomyces griseus prevent together against gram-positive and...
Gönderen 29,76 € *
Antide Acetate Antide Acetate
Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s body to represses FSH and LH releases that stem from the pituitary gland. Synthetic versions of this chemical have been developed for...
Gönderen 186,73 € *
Apramycin sulfate chemical structure Apramycin sulfate
Apramycin is produced from Streptomyces tenebrarius . It is used to study antibiotic resistance as well as protein synthesis translocation-step inhibition in bacteria and prokaryotes. Apramycin is an aminoglycoside antibioticum and has a...
Gönderen 62,30 € *
İpucu!
AQ97 High Fidelity proofreading Polymerase - ngs results AQ97 High Fidelity proofreading Polymerase
AQ97 High Fidelity DNA Polymerase is a proofreading enzyme for robust amplification of DNA targets with low to high GC content and long DNA targets of 18 kb. The DNA binding domain of this polymerase, ensures excellent high fidelity,...
Gönderen 99,00 € *
İpucu!
AQ97 High Fidelity Mastermix AQ97 High Fidelity MasterMix 2X
AQ97 High Fidelity DNA Polymerase MasterMix 2X is a ready-to-use 2x PCR mix composed of AQ97 High Fidelity DNA Polymerase and an optimised buffer system including dNTPs and magnesium chloride, allowing robust amplification on DNA target...
Gönderen 118,45 € *
ATP - Adenosine-5'-triphosphate ATP (Adenosine 5'-Triphosphate), disodium salt
Adenosine triphosphate (ATP) is the universal and immediately available energy source in cells and an important regulator of energy providing processes. The molecule adenosine triphosphate consists of an adenine, the sugar ribose and...
Gönderen 50,25 € *
AVG-Cl AVG-Cl
(S)-trans-2-Amino-4-(2-aminoethoxy)-3-butenoic acid hydrochloride. AVG (Aminoethoxyvinyl glycine hydrochloride) is a potent inhibitor of ethylene synthesis in plants acting at the level of 1­aminocyclopropanecarboxylic acid synthase....
Gönderen 343,35 € *
B-Enhancer solution B-Enhancer solution
The better performance of the Genaxxon bioscience 5X B-Enhancer Solution compared to standard enhancers such as form amide, DMSO, TMCA or BSA especially when used with GC rich regions or templates with a high degree of secondary...
Gönderen 12,05 € *
Bacitracin chemical structure Bacitracin powder, min. 55 IU/mg
Bacitracin from Bacillus licheniformis consists of several peptides (A, B, C, D, E, F1-3), bacitracin A, a cyclic dodecapeptide, being the most important component with approximately 70%. For its bactericidal action, the presence of...
Gönderen 64,20 € *
Basal Medium (Eagle) with EBSS w/o NaHCO3 Basal Medium (Eagle) with EBSS w/o NaHCO3
Basal Medium (Eagle) with EBSS, 1.0g/L glucose, without NaHCO3. Special preparation. Minimal order size: 20 x 500mL. In the fifties of the last century it became clear that mammalian cells need not only the 10 essential amino acids, but...
55,57 € *
Basal Medium (Eagle) with EBSS, w/o phenol red - 500 mL Basal Medium (Eagle) with EBSS, w/o phenol red...
Basal Medium (Eagle) with EBSS, 1.0g/L glucose, with 2.2g/L NaHCO3, without Phenol red. Special preparation. Minimal order size: 20 x 500mL. In the fifties of the last century it became clear that mammalian cells need not only the 10...
58,26 € *
Basal Medium (Eagle) with EBSS, without Glutamine, without Glucose - 500mL Basal Medium (Eagle) with EBSS, without...
Basal Medium (Eagle) with EBSS without Glutamine, without Glucose, with Phenol red, with 2.2g/L NaHCO3. In the fifties of the last century it became clear that mammalian cells need not only the 10 essential amino acids, but also Cystine,...
16,29 € *
BCIP, molecular biology grade BCIP, molecular biology grade
BCIP (5-bromo-4-chloro-3-indolyl phosphate, p-toluidine salt) is a chromogenic substrate for alkaline phosphatase, used in combination with the oxidant NBT (nitro blue tetrazolium) to enhance blue color development. Applications: When...
Gönderen 73,97 € *
BES - N,N-Bis(2-hydroxyethyl)-2-aminoethanesulfonic acid BES (buffer quality)
BES (N,N-bis(2-hydroxyethyl)-2-aminoethanesulfonic acid) is a useful secondary standard biochemical buffer. Useful pH range for BES is 6.4 to 7.8. It is useful for diagnostic assay manufacturing industry. BES, a sulfonic acid-containing...
Gönderen 30,19 € *
Bestatin hydrochloride Bestatine Hydrochloride
Bestatin is a potent aminopeptidase inhibitor. The compound has multiple physiological functions including the ability to act as an immunomodifier and enhance the proliferation of human bone marrow granulocyte-macrophage progenitor cells...
Gönderen 140,70 € *
Bicine buffer grade Bicine buffer grade
Bicine is recommended for low temperature biochemical work and for the preparation of stable substrate solution for serum guanase determination. Bicine is used for different applications, ranging from buffers used in enzymatic reactions...
Gönderen 79,70 € *
Bio Lp-1 Legionella DNA Purification Kit Bio Lp-1 Legionella DNA Purification Kit
The Bio Lp-1 Legionella DNA Purification Kit was specially developed for our Bio Lp 1 Legionella Detection kit .This Kit provides yields of 75% to 99% dependend on the DNA source and elution volume which can be in the range of 40µL up to...
256,48 € *
Biotin-11-dUTP Solution, min. 96% (1mM) Biotin-11-dUTP Solution, min. 96% (1mM)
Biotin-11-dUTP (Biotin-11-2'-deoxyuridin-5'-triphosphat - Tetralithiumsalt) is a commonly used component for non-radioactive labelling of DNA. Biotin-11-dUTP can be incorporated into DNA enzymatically by Nick-Translation, random-priming,...
Gönderen 253,18 € *
Bis-Tris for biological buffers Bis-Tris, p.A.
2-[Bis(2-hydroxyethyl)imino]-2-(hydroxymethyl)-1,3-propandiol. Puffersubstanz: Daboo M. and Bates R. (1970) J. Phys. Chem., 74, 702-5. Bis-Tris is an amino buffer very similar in its chemical structure to Trizma ("Tris": e.g. M6210 > or...
Gönderen 127,24 € *
Bleomycin sulfate, lyophil. pure Bleomycin sulfate, lyophil. pure
Group of glycopeptide antibiotics from Streptomyces verticillus with antineoplastic properties by inhibition of DNA synthesis. Bleomycin sulfate is a mixture of bleomycin A2 and bleomycin B2 as the major components. Bleomycin sulfate...
Gönderen 162,17 € *
Bluo-Gal - 5-Bromo-3-indolyl-beta-D-galactopyranosid Bluo-Gal /...
5-Bromo-3-indolyl-β-D-galactopyranosid (Bluo-Gal) ist used as a substrat of β-Galactosidase. It is a chromogenic substrate suitable for identification of lacZ + bacterial colonies. Bluo-Gal is designed to replace X-Gal in blue-white...
Gönderen 126,78 € *
Borate buffered saline tablets (pH8.2) - 100 tablets Borate buffered saline tablets (pH8.2) - 100...
1 tablet dissolved in 500mL of deionized water yields: 0.01M Borate buffer, 0.15M Sodium chloride, pH8.2 at 25°C.
249,81 € *
Calcium lactate pentahydrate Calcium lactate pentahydrate
Calcium lactate pentahydrate - Lactic acid calcium salt Synonym: L-Lactic acid calcium salt; Calcium L-lactate pentahydrate; Calcium L-lactate pentahydrate; Calcii lactas pentahydricus; L-Lactic acid calcium salt; Calcium lactate...
118,97 € *
CAPS, 3-(Cyclohexylamino)-1-propane, 3-(Cyclohexylamino)-1-propanesulfonic acid CAPS >99% pure - buffer grade
3-(Cyclohexylamino)-1-propane sulfonic acid
Gönderen 75,50 € *
Carbonate-Bicarbonate buffer tablets (pH9.6) Carbonate-Bicarbonate buffer tablets (pH9.6)
1 tablet dissolved in 100mL of deionized water yields: 0.05M Sodium Carbonate-bicarbonate buffer, 0.05% Sodium Azide, pH9.6 at 25°C.
Gönderen 78,27 € *
ready-to-use Carbonate-Bicarbonate buffer tablets Carbonate-Bicarbonate buffer tablets (pH9.6)
1 tablet dissolved in 100mL of deionized water yields: 0.05M Sodium Carbonate-bicarbonate buffer, pH9.6 at 25°C. No time consuming and expenisve calibration / pH-measuring necessary. Just dissolve buffer talets in water and use buffer...
Gönderen 101,25 € *
Cesium chloride Caesium chloride (99.9 %), Molecular biology grade
Caesium chloride for density centrifµgation. Ideal for the isolation of highly pure RNA without contamination with RNase, or other proteins and DNA. Ref.: Miller H. (1987) Methods Enzymol., 152, 145, Dorin M. and Bornecque C.A. (1995)...
Gönderen 115,00 € *
Cesium chloride Caesiumchlorid ultrapure (99,999%)
Caesium chloride for density centrifugation. Ideal for the isolation of highly pure RNA without contamination with RNase, or other proteins and DNA. Ref.: Miller H. (1987) Methods Enzymol., 152, 145, Dorin M. and Bornecque C.A. (1995)...
945,00 € *
CD20 188-196 (HLA-A*02:01) HLA-A*02:01 SLFLGILSV CD20 188-196 (HLA-A*02:01) HLA-A*02:01 SLFLGILSV
Gönderen 85,50 € * 90,00 € *
CD22-4 (371-379) HLA-A*02:01 RLLGKESQL CD22-4 (371-379) HLA-A*02:01 RLLGKESQL
Gönderen 85,50 € * 90,00 € *
CentriPure P100 protein purification columns CentriPure 100 columns for protein purification
CentriPure 100 columns are pre-hydrated gel filtration columns for protein purification and desalting. CentriPure 100 Gel Filtration Columns are designed for rapid and efficient removal of small molecules (salts, dyes, ammonia, haptens,...
Gönderen 55,50 € *
CentriPure P2 purification columns for proteins CentriPure 2 columns for protein purification
Hydrated gel filtration columns for protein purification and desalting. Processes sample volumes of 150 to 300µL. CentriPure 2 Gel Filtration Columns are designed for rapid and efficient removal of small molecules (salts, dyes, ammonia,...
Gönderen 25,00 € *
CentriPure P5 protein purification columns for 500µL sample volume CentriPure 5 columns for Purification of Proteins
CentriPure 5 columns are pre-hydrated gel filtration columns for protein purification and desalting. Process sample volume of 500µL. CentriPure 5 Gel Filtration Columns are designed for rapid and efficient removal of small molecules...
Gönderen 23,79 € *
CentriPure P50 protein purification columns CentriPure 50 columns for protein purification
CentriPure 50 columns are pre-hydrated gel filtration columns for protein purification and desalting. Processes sample volumes of 5mL. CentriPure 50 Gel Filtration Columns are designed for rapid and efficient removal of small molecules...
Gönderen 25,00 € *
fast Dye Terminator removal CentriPure Dye Terminator - 96-well plates
For the rapid and reliable removal of excess dye terminators, primer, dNTPs and other small molecules from completed DNA sequencing reactions, e.g. from BigDye™ Cycle Sequencing reactions. Samples from 20µL can be processed reliably and...
Gönderen 156,34 € *
CentriPure CP-0219 columns CentriPure Mini Dye Terminator columns
Die CentriPure CP-0219 columns are specially designed for purification and desalting of oligonucleotides longer than 20 base pairs and from proteins greater than 25 kDa with minimal dilution. The gel bed has a volume of 0.5mL. Samples...
Gönderen 16,77 € *
CentriPure Z25 Mini Spin columns CentriPure Z25 Mini Spin columns
CentriPure Z25 Mini Spin columns are prehydrated (in water) Mini Columns used for quick and efficient desalting, buffer exchange and/or removal of dyes and small molecules (haptens, biotin, ammonium, etc.) from proteins greater than 5...
Gönderen 25,00 € *
CHAPS chemical structure CHAPS for 2D-gel electrophoresis
CHAPS is a nondenaturing zwitterionic detergent for membrane biochemistry, isoelectric focusing and two-dimensional electrophoresis. Useful for solubilizing membrane proteins and breaking protein-protein interactions. Its small micellar...
Gönderen 132,42 € *
CHAPS buffer grade CHAPS buffer grade
CHAPS is a nondenaturing zwitterionic detergent for membrane biochemistry, isoelectric focusing and two-dimensional electrophoresis. Useful for solubilizing membrane proteins and breaking protein-protein interactions. Its small micellar...
Gönderen 89,55 € *
CHAPSO; 3-([3-Cholamidopropyl]dimethylammonio)-2-hydroxy-1-propanesulfonate CHAPSO - min. 99.0% (HPLC)
3-[(3-Cholamidopropyl)-dimethylammonio]-2-hydroxy-1-propane sulfonate
Gönderen 100,43 € *
İpucu!
CHES - chemical structure CHES, min. 99.0%
CHES shows a pKa (25°C) of 9,55 which makes CHES useful as a buffering component in the pH range between 8.6 to 12.0. CHES interferes in the protein quantification according to Lowry. It is used in crystallisation of Phosphotriesterase...
Gönderen 45,64 € * 91,27 € *
Chymotrypsinogen A - Chymotrypsin precursor Chymotrypsinogen A - Chymotrypsin precursor
Chymotrypsinogen is the practically inactive "precursor" (proenzyme, or zymogen) of chymotrypsin. In order to be activated, chymotrypsinogen has to be cleaved by trypsin between the amino acids arginine and isoleucine (R15 and I16) ,...
395,45 € *
Sodium citrate dihydrate Citric acid trisodium salt dihydrate, p.A. min....
Citric acid trisodium salt (tri-sodium citrate, sodium citrate) is used as a buffering substance for molecular biology buffers.
Gönderen 50,55 € *
CMRL-1066 with L-Glutamine CMRL-1066 with L-Glutamine
CMRL-1066 with L-Glutamine, without Phenol red, with 2.2g/L NaHCO3, sterile filtered. CMRL is a nucleoside and vitamin-rich medium. In the past it was developed to clone monkey-kidney cells and as long time culture medium for L-cells. It...
62,32 € *
CMRL-1066 without L-Glutamine, without Phenol red CMRL-1066 without L-Glutamine, without Phenol red
CMRL-1066 without L-Glutamine, without Phenol red, with 2.2g/L NaHCO3, sterile filtered. CMRL is a nucleoside and vitamin-rich medium. In the past it was developed to clone monkey-kidney cells and as long time culture medium for L-cells....
34,26 € *
CMV IE-1 (199-207) - ELRRKMMYM CMV IE-1 (199-207) - ELRRKMMYM
CMV IE-1 ELRRKMMYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in...
Gönderen 72,00 € * 90,00 € *
CMV IE-1 (316-324) (I1) HLA-A*02:01 ILEETSVML CMV IE-1 (316-324) (I1) HLA-A*02:01 ILEETSVML
Antigen peptide IE (316-324) (I1) HLA-A*02:01 (ILEETSVML) for stimulation of antigen-specific T cells in T cell assay such as ELISPOT, ICS, cytotoxicity or proliferation assays. ILEETSVML has an amino acid substitution at position 316...
Gönderen 76,00 € * 95,00 € *
CMV IE-1 (316-324) HLA-A*0201 VLEETSVML CMV IE-1 (316-324) HLA-A*0201 VLEETSVML
CMV IE-1 (316-324) HLA-A * 0201 VLEETSVML for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. IE-1 stands for immediate-early protein 1. CMV stands for human cytomegealovirus, or HCMV for human...
Gönderen 116,00 € * 145,00 € *
CMV IE-1 (99-107) RIKEHMLKK CMV IE-1 (99-107) RIKEHMLKK
IE-1 stands for immediate-early protein 1. CMV stands for human cytomgealovirus, HCMV for human cytomegalovirus or HPV human herpesvirus.
Gönderen 76,00 € * 95,00 € *
CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY
CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von MHC-Klasse-I-Molekülen präsentiert wird.
Gönderen 85,50 € * 90,00 € *
CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK
CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for human cytomegalovirus, or HCMV for human cytomegalovirus or HPV human herpesvirus.
Gönderen 72,00 € * 90,00 € *
CMV pp65 (417-426) HLA-B*07:02 TPRVTGGGAM CMV pp65 (417-426) HLA-B*07:02 TPRVTGGGAM
CMV pp65 (417-426) HLA-B * 07: 02 TPRVTGGGAM for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for human cytomegalovirus, or HCMV for human cytomegalovirus or HPV human herpesvirus.
Gönderen 108,75 € * 145,00 € *
CMV pp65 (417-426), amid HLA-B*07:02 TPRVTGGGAM-NH2 CMV pp65 (417-426), amid HLA-B*07:02...
CMV pp65 (417-426) HLA-B * 07: 02 TPRVTGGGAM for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for human cytomegalovirus, or HCMV for human cytomegalovirus or HPV human herpesvirus.
Gönderen 140,25 € * 165,00 € *
cmv_pp65_495_503_nlvpmvatv CMV pp65 (495-503) HLA-A*02:01 NLVPMVATV
Single peptide (NLVPMVATV) for stimulation of human CMV specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele. Purities offered: >95%. T-cell epitopes are presented on the surface of...
Gönderen 116,00 € * 145,00 € *
Co-NTA-Agarose for His-tagged proteins Co-NTA-Agarose for His-tagged proteins
NTA-Agarose consists of the tetradentate chelating agent, nitrilotriacetic acid (NTA), covalently coupled agarose beads, and is loaded with Co2+ ions. In processing recombinant fusion proteins from eukaryotes or in the case of special...
Gönderen 215,99 € *
Co-NTA MagBeads for His-tagged protein purification Co-NTA MagBeads for His-tagged protein...
Protein purification based on magnetic beads has become popular because they are useful to extract proteins from diluted solutions, such as cell culture supernatants purify proteins expressed at low levels perform pull-down experiments...
Gönderen 108,01 € *
Coenzyme A trilithium salt Coenzyme A trilithium salt (>93%)
Coenzyme A (CoA, CoASH, HSCoA) is a coenzyme that facilitates enzymatic acyl-group transfer reactions and supports the synthesis and oxidation of fatty acids. CoA is involved in the mechanisms of a wide variety of enzymes.
Gönderen 146,64 € *
Colcemid - chemical structure Colcemid - 10mL
Colcemid inhibits the formation of mitotic spindles. It is used to increase the percentage of metaphase cells for chromosome analysis. Colcemid depolymerizes microtubules; blocks mitosis at metaphase. Often in karyotyping and cell cycle...
21,50 € *
Colchicine chemical structure Colchicine
Colchicine is an antimitotic agent that disrupts microtubules by binding to tubulin and preventing its polymerization. Stimulates the intrinsic GTPase activity of tubulin. Induces apoptosis in several normal and tumor cell lines and...
Gönderen 86,33 € *
Collagenase Type I - with a balanced activity of collagenase, clostripain as well as tryptic and proteolytic activities.es. Collagenase Type I (EC 3.4.24.3) >100 units/mg
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Collagenase type I shows a balanced activity of collagenase, clostripain as well as tryptic and proteolytic...
Gönderen 79,94 € * 114,20 € *
Collagenase Type II - high clostripain activity Collagenase Type II (EC 3.4.24.3) >180 units/mg
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Type II Collagenase is recommended for the preparation of cells from liver, bone, thyroid gland, heart and...
Gönderen 79,94 € * 114,20 € *
Collagenase Type III - normal Collagenase, but very low proteolytic activity Collagenase Type III (EC 3.4.24.3)
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Collagenase type III shows normal Collagenase, but very low proteolytic activity. Type III Collagenase is...
1.364,75 € *
Collagenase IV - low tryptic, high collagenase and normal clostripain activity. Collagenase Type IV (EC 3.4.24.3) >900 units/mg
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Collagenase type IV has low tryptic, high collagenase and normal clostripain activity. Type I Collagenase is...
Gönderen 100,00 € * 125,00 € *
Collagenase Substrate Component A Collagenase-Chromophore-Substrate Component A
Collagenase-Chromophore-Substrate Component A also named 4-Phenylazobenzyloxycarbonyl-Pro-Leu-Gly-Pro-D-Arg-OH x 2H2O.
407,69 € *
Crystal structure of Ni, Ca Concanavalin A Concanavalin A lectin
Concanavalin A is a member of a group of proteins called lectins which are proteins that react with specific sugar residues. It has broad applicability and is the most widely used lectin within molecular biology research. The...
Gönderen 87,75 € *
Coral Red PCR Buffer - coloured PCR buffer for visualization of pipetting steps Coral Red Buffer Dye solution (10X)
Coral Red Buffer is a 10-time dye solution as supplement for PCR buffers. This additive contains Glycerol, EDTA, a red and a yellow dye. 5µL of this solution are added to 45µL of the PCR assay before the PCR reaction to stain it red. An...
Gönderen 23,84 € *
Coronavirus 2019 Nucleocapsid Mosaic Protein Coronavirus 2019 Nucleocapsid Mosaic Protein
The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused to 6xHis tag at C-terminal. The protein is supplied as a sterile filtered clear...
Gönderen 243,34 € *
Coumarin 120 / AMC Coumarin 120 / AMC
7-Amino-4-methylcoumarin. Fluorophore for preparing fluorogenic substrates for cystine aminopeptidase (and other hydrolases). Used as reference compound in the enzyme assay.
630,39 € *
Coumarin 6 - 2 g Coumarin 6 - 2 g
3-(2-Benzothiazolyl)-7-(diethylamino)coumarin
Gönderen 114,44 € *
Cryo tubes 4.0 mL (sterile) - 5 x 100 tubes Cryo tubes 4.0 mL (sterile) - 5 x 100 tubes
Cryo tubes specially designed for the storage of biological material down to -196°C (liquid nitrogen) to ensure a tight, leakproof seal even at lowest temperatures. All vials are the standard 12.5mm diameter, and come in volumes from 1.2...
245,98 € *
cAMP - Adenosine-3',5'-cyclic monophosphate sodium salt Adenosine-3',5'-cyclic monophosphate sodium...
Adenosine-3′,5′-cyclic monophosphate (cAMP) is an activator of cyclic-AMP-dependent protein kinase A (PKA). The cAMP/PKA signaling pathway has been shown to inhibit cell proliferation, induce differentiation and lead to apoptosis, eg. in...
Gönderen 197,99 € *
CyLoP-1 peptide (CRWRWKCCKK) CyLoP-1 peptide (CRWRWKCCKK)
CPPs, such as CyloP-1, are generally taken up by endocytic pathways, with vesicular encapsulation being a limiting factor in intracellular targeting. CyLoP-1 has been developed because it exhibits a pronounced diffuse cytosolic...
Gönderen 144,00 € * 160,00 € *
Cytosine Cytosine
Cytosin, 4-Amino-2-hydroxypyrimidine. Cytosine is one of the four main bases found in DNA and RNA, along with adenine, guanine, and thymine (uracil in RNA). It is a pyrimidine derivative, with a heterocyclic aromatic ring and two...
Gönderen 86,48 € *
YENİ
D-(+)-Galacturonic acid D.(+)-Galacturonic acid monohydrate (>98% by...
Galacturonic acid (GalA) is the primary building block of mainly pectin but also other biopolymers found in plants. The polymeric GalA chains in pectin, are linked by alpha-1,4 glycosidic bonds. Some of the carboxyl groups are methylated...
Gönderen 175,00 € *
D-Galactosamine x HCl D-Galactosamine x HCl
Galactosamine is a hexosamine derived from galactose with the molecular formula C6H13NO5. This amino sugar is a constituent of some glycoprotein hormones such as follicle-stimulating hormone (FSH) and luteinizing hormone (LH). Other...
Gönderen 123,50 € *
D-Glucosamine x HCl, min. 99% (HPLC) D-Glucosamine x HCl, min. 99% (HPLC)
CAS: [66-84-2] - C6H13NO5 x HCl
Gönderen 76,99 € *
firefly luciferin chemical structure D-Luciferin potassium salt
D-Luciferin also named Firefly Luciferin is the most popular and versatile bioluminescent substrate. Firefly luciferase produces light by the ATP-dependent oxidation (Mg2+ as cofactor) of luciferin. It emits a characteristic yellow-green...
Gönderen 87,55 € *
D-Mannitol, min. 98% (HPLC) D-Mannitol, min. 98% (HPLC)
D-Mannitol. Purity >99.3%, CAS: [69-65-8] - C6H14O6
Gönderen 54,98 € *
D-Mannose, min. 99% (HPLC) D-Mannose, min. 99% (HPLC)
CAS: [3458-28-4] - C6H12O6
Gönderen 39,60 € *
D-Raffinose 5-hydrate D-Raffinose pentahydrate (min. 98% HPLC)
D-Raffinose also known as O-α-D-Galactopyranosyl-(1→6)-α-D-glucopyranosyl β-D-fructofuranoside; Melitose; Melitriose; Melitose pentahydrate.
Gönderen 68,20 € *
D-TAT (47-57) ygrkkrrqrrr-NH2 D-TAT (47-57) ygrkkrrqrrr-NH2
Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable macromolecules, such as peptides, proteins, nucleic acids and nanoparticles. CPPs are usually...
Gönderen 287,50 € *
D-Xylulose (min. 99%) D-Xylulose (min. 99%)
Synonyms: D-threo-pent-2-ulose. Xylulose a ketopentose, is a monosaccharide containing five carbon atoms, and including a ketone functional group. In nature, it occurs in both the L- and D-enantiomers. L-Xylulose accumulates in the urine...
Gönderen 364,06 € *
D(+)-Fucose D(+)-Fucose (6-Deoxy-D-galactose), min. 99%
D-Fucose (6-Deoxy-D-galactose) may be used for different purposes. 1. In studies of fucoidan polysaccharide containing glycans. 2. D-Fucose is used as a substrate to identify, differentiate and characterize enzymes such as the...
Gönderen 81,11 € *
D(+)-Galactose from beech (min. 98.0% HPLC) D(+)-Galactose from beech (min. 98.0% HPLC)
Highly pure D(+)-Galactose derived from beech. Guaranteed free of any animal contaminants!
Gönderen 50,75 € *
D(+)-Galactose from lactose (min. 98.0% HPLC) D(+)-Galactose from lactose (min. 98.0% HPLC)
Galactose is a monosaccharide. When combined with glucose (monosaccharide), through a condensation reaction, the result is the disaccharide lactose. The hydrolysis of lactose to glucose and galactose is catalyzed by the enzymes lactase...
Gönderen 39,60 € *
D(+)-Maltose monohydrate Biochemica (min. 95% HPLC) D(+)-Maltose monohydrate Biochemica (min. 95%...
Maltobiose, 4-O-a-D-Glucopyranosyl-D-glucose, CAS: [6363-53-7] - C12H22O11H2O
Gönderen 44,00 € *
Trehalose chemical structure D(+)-Trehalose dihydrate, min. 98% (HPLC)
Trehalose , also known as mycose or strong>tremalose, is a natural alpha-linked disaccharide formed by an alpha,alpha(1,1) glucoside bond between two alpha-glucose units. It can be synthesised by bacteria, fungi, plants, and invertebrate...
Gönderen 104,74 € *
D(+)Glucose 20% - 5 bags D(+)Glucose 20% - 5 bags
Content of 1 pouch dissolved in deionized water and made up to 1000mL yields: 20% D(+)Glucose
165,74 € *
DABCYL DABCYL
4-[[4-(Dimethylamino)-phenyl] azo]-benzoic acid
Gönderen 113,56 € *
DAF-4 DAF-4
766,86 € *
DAF-4T DAF-4T
879,89 € *
DAF-FM DAF-FM / 3-Amino-4-(N-methylamino)-2',...
3-Amino-4-(N-methylamino)-2',7'-difluorofluorescein diacetate. DAF-FM DA is an important reagent for quantification of low concentrations of nitric oxide in solution. This compound is essentially nonfluorescent until it reacts with NO to...
Gönderen 399,73 € *
DAF-FM DA DAF-FM DA /...
3-Amino-4-(N-methylamino)-2',7'-difluorofluorescein diacetate. DAF-FM DA is an important reagent for quantification of low concentrations of nitric oxide in solution. This compound is essentially nonfluorescent until it reacts with NO to...
Gönderen 399,73 € *
DAPI - 4',6-Diamidino-2-phenylindole dihydrochloride DAPI - 4',6-Diamidino-2-phenylindole...
4',6-Diamino-2-phenylindole hydrochloride is a fluorescent dye binding selectively to the minor groove of double strand DNA (preferentially to AT rich DNA). Forms a stable complex which fluoresces approximately 20 times more than DAPI...
Gönderen 91,75 € *
DAR 1T DAR 1T
734,59 € *
DAR-1 / 4,5-Diamino-rhodamine B DAR-1 / 4,5-Diamino-rhodamine B
4,5-Diamino-N,N,N',N'-tetraethyl-rhodamine. Sensitive NO probe, LOD of 10 nM, shows higher photostability than the classical fluorescein derivative DAF.
Gönderen 156,85 € *
5,6-Diamino-N,N,N',N'-tetraethylrhodamine DAR-2
DAR-2 (5,6-Diamino-N,N,N',N'-tetraethyl-rhodamine) is a sensitive NO probe, LOD of 10nM, shows higher photostability than the classical fluorescein derivative DAF.
169,53 € *
DAR-2T DAR-2T
783,02 € *
DAR-4MT DAR-4MT
928,31 € *
2'-Deoxyadenosine 5'-triphosphate - dATP dATP (2'-deoxyadenosine 5'-triphosphate)...
Highly pure, HPLC purified 2'-Deoxyadenosine 5'-triphosphate (dATP >99%) delivered as 100 mM soution for use in qPCR, standard PCR, RT-PCR and Klenow reactions. The Genaxxon dNTP solutions are optimized for their use in DNA...
Gönderen 45,00 € *
DCCS - 100 mg DCCS - 100 mg
7-Diethylaminocoumarin-3-carboxylic acid N-succinimidyl ester
352,33 € *
2'-Deoxycytidine 5'-triphosphate - dCTP dCTP solution - 100mM
100mM solution of 2'-Deoxycytidine 5'-triphosphate (dCTP) of purity >99%. Product has been tested for PCR products of length up to 10kb. Highly pure, HPLC purified Deoxycytidine 5'-triphosphate, tetrasodium salt (dCTP / >99%) delivered...
Gönderen 45,00 € *
Demecoline chemical structure Demecolcine - 25 mg
Colcemide (trademark of Ciba-Geigy Corporation). Demecolcine, N-Deacetyl-N-methylcolchicine. Used for cell synchronization by arresting them at metaphase. Qualified for use in animal component free applications.
605,43 € *
Dermcidin - DCD-1 (SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSV) Dermcidin - DCD-1...
Dermcidin-1L (DCD-1) is a 47-amino acid antimicrobial peptide (AMP). It is expressed in eccrine sweat glands, secreted into sweat at a concentration of 1-10µg/mL, and transported to the epidermal surface. Unlike most AMPs, which are...
Gönderen 850,00 € *
Dermcidin - DCD-1L (SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL) Dermcidin - DCD-1L...
Dermcidin-1L (DCD-1L) is a 48-amino acid antimicrobial peptide (AMP) with a Leu residue on the C-terminus. It is expressed in eccrine sweat glands, secreted into sweat at a concentration of 1-10µg/mL, and transported to the epidermal...
Gönderen 925,00 € *
DNA free Taq Polymerase from Genaxxon DF Taq Polymerase E (DNA free)
Especially suitable for use in microbiology, the DNA freeTaq Polymerase DF Taq E for high yields is virtually free of foreign DNA. The special purification procedure guarantees Taq Polymerase free of any DNA impurities, especially free...
Gönderen 74,35 € *
DNA free Taq Polymerase from Genaxxon DF Taq Polymerase S (DNA-free)
Especially suitable for use in microbiology, the DNA free Taq Polymerase DF Taq S for high specificity is virtually free of foreign DNA. The special purification procedure guarantees DF Taq Polymerase free of any DNA impurities,...
Gönderen 74,35 € *
2'-Deoxyguanosine 5'-triphosphate - dGTP dGTP (2'-Deoxyguanosine 5'-triphosphate)...
Highly pure, HPLC purified 2'-Deoxyguanosine 5'-triphosphate (dGTP / >99%) delivered as 100 mM soution for use in qPCR, standard PCR, RT-PCR and Klenow reactions. The Genaxxon dNTP solutions are optimized for their use in DNA...
Gönderen 45,00 € *
DIB-Cl / 4-(4,5-Diphenyl-imidazol-2-yl)benzoyl-chloride DIB-Cl /...
4-(4,5diphenyl-1H-imidazol-2-yl)-benzoyl chloride (DIB-Cl) as reagent for amines was used successfully to derivatize and fluorescence detection enantiomers of methamphetamin and phydroxymethamphetamin, in urine samples. DIBCl showed...
Gönderen 251,84 € *
Diethylenglycol chemical structure Diethylene glycol
Diethylene glycol is a colourless liquid which is mostly used in manufacturing other chemicals. It is denser than water. It can be formed as a side reaction during ester interchange of dimethyl terephthalate with ethylene glycol, it can...
37,81 € *
Diethyl pyrocarbonate - chemical structure DEPC
Diethylpyrocarbonate modifies histidyl residues in proteins and leads to their inactivation. In molecular biology it is mainly used as a strong inhibitor of RNase activity. In addition, DEPC reacts with adenosine of single stranded...
Gönderen 82,09 € *
DIHFP - 25 mg DIHFP - 25 mg
Diphenyliodonium hexafluorophosphate
241,40 € *
Dihydroethidium Dihydroethidium
Synonym: 2,7-Diamino-10-ethyl-9-phenyl-9,10-dihydrophenanthridine; 3,8-Diamino-5,6-dihydro-5-ethyl-6-phenylphenanthridine; Hydroethidine
314,63 € *
Dihydrorhodamine 123 - DHR Dihydrorhodamine 123 - DHR
Dihydrorhodamine 123 is a cell-permeable non-fluorescent substance used as an indicator for reactive oxygen species (ROS) substances. Dihydrorhodamine 123 will diffuse across membranes where it is oxidized by peroxynitrite to rhodamine...
Gönderen 91,93 € *
DL-Dithiothreitol DL-Dithiothreitol (DTT) - BioChemica
Dithiothreitol (DTT) is an isomer (epimer) of dithioerythritol (DTE). In principle, DTT can be exchanged for DTE or DTE for DTT, of which both are excellent reducing substances. Dithiothreitol (DTT), like ß-mercaptoethanol, is used as a...
Gönderen 50,06 € *
DL-Dithiothreitol DL-Dithiothreitol (DTT) - Molecular biology grade
Dithiothreitol (DTT) is an isomer (epimer) of dithioerythritol (DTE). In principle, DTT can be exchanged for DTE or DTE for DTT, of which both are excellent reducing substances. Dithiothreitol (DTT), like ß-mercaptoethanol, is used as a...
Gönderen 62,85 € *
DMEM for SILAC(TM) w/o Glutamine, w/o Arginine, w/o Lysin, with 4.5g/L Glucose DMEM for SILAC(TM) w/o Glutamine, w/o...
Dulbecco's Modified Eagle Medium (DMEM), with 4.5g/L glucose, no glutamine, no lysine, no arginine is a basal cell culture medium for use during SILAC™ protein labeling with stable isotopic labeled lysine and/or arginine. Special...
65,00 € *
DMEM with 1g/L L-Glucose, w/o glutamine, w/oL-Isoleucine DMEM with 1g/L L-Glucose, w/o glutamine,...
Dulbecco's Modified Eagle Medium (DMEM), 1.0g/L glucose, no L-glutamine, no L-isoleucine. Special preparation. Minimum order size: 20 x 500mL. DMEM, intrinsically developed for the cultivation of murine embryonic cells, is tailor-made...
65,00 € *
DMEM with L-glutamine, w/o Glucose, w/o Serine - 500 mL DMEM with L-glutamine, w/o Glucose, w/o Serine...
Dulbecco's Modified Eagle Medium (DMEM), with L-glutamine, no glucose, no serine, no Sodium pyruvate. Special preparation. Minimum order size: 20 x 500mL. DMEM, intrinsically developed for the cultivation of murine embryonic cells, is...
65,00 € *
DMEM with L-Glutamin, with 1.0g/L Glucose DMEM with L-Glutamin, with 1.0g/L Glucose
DMEM with L-Glutamine, with 1.0g/L glucose, with Sodium pyruvate, without Phenol red, with 3,7g/L NaHCO3. DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal medium for supporting the growth of many different mammalian cells....
15,75 € *
DMEM with high Glucose DMEM with L-Glutamin, with 4,5g/L Glucose
DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal medium for supporting the growth of many different mammalian cells. Cells successfully cultured in DMEM include primary fibroblasts, neurons, glial cells, HUVECs, and smooth...
17,20 € *
DMEM with L-Glutamine, with 4.5g/L Glucose, w/o Phenol red DMEM with L-Glutamine, with 4.5g/L Glucose, w/o...
DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal medium for supporting the growth of many different mammalian cells. Cells successfully cultured in DMEM include primary fibroblasts, neurons, glial cells, HUVECs, and smooth...
14,76 € *
DMEM with L-glutamine, with 4.5g/L Glucose, w/o Serine - 500 mL DMEM with L-glutamine, with 4.5g/L Glucose, w/o...
Dulbecco's Modified Eagle Medium (DMEM), 4.5g/L glucose, no serine, no Sodium pyruvate. Special preparation. Minimum order size: 20 x 500mL. DMEM, intrinsically developed for the cultivation of murine embryonic cells, is tailor-made for...
65,00 € *
DMEM medium with stable glutamine DMEM with stable Glutamin, with 4.5g/L Glucose
DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal medium for supporting the growth of many different mammalian cells. Cells successfully cultured in DMEM include primary fibroblasts, neurons, glial cells, HUVECs, and smooth...
15,34 € *
DMEM with stable Glutamine, with 1.0g/L Glucose DMEM with stable Glutamine, with 1.0g/L Glucose
DMEM (low glucose) with stable glutamine (L-alanyl-L-glutamine), with 1.0g/L glucose. Equivalent/alternative to: Biochrom Cat.-no. FG 0415, or to Bio&Sell No. BS.FG0415 DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal...
15,75 € *
DMEM w/o Glutamine, w/o Arginine, w/o Lysin, w/o Methionine with 4.5g/L Glucose DMEM w/o Glutamine, w/o Arginine, w/o Lysin,...
Dulbecco's Modified Eagle Medium (DMEM), 4.5g/L glucose, no glutamine, no lysine, no arginine, no methionine is a basal cell culture medium for use during SILAC™ protein labeling with stable isotopic labeled lysine and/or arginine....
65,00 € *
DMEM w/o arginine, w/o glutamine, with Sodium pyruvate, with 4.5g/L glucose DMEM w/o arginine, w/o glutamine, with Sodium...
Dulbecco's Modified Eagle Medium (DMEM), 4.5g/L glucose, no L-glutamine, no L-arginine, with Sodium pyruvate. Special preparation. Minimum order size: 20 x 500mL. DMEM, intrinsically developed for the cultivation of murine embryonic...
65,00 € *
DMEM w/o Glutamin, with 4.5g/L Glucose, w/o Sodium pyruvate, w/o Phenol red DMEM w/o Glutamin, with 4.5g/L Glucose, w/o...
DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal medium for supporting the growth of many different mammalian cells. Cells successfully cultured in DMEM include primary fibroblasts, neurons, glial cells, HUVECs, and smooth...
18,60 € *
DMEM w/o glutamine, with 4.5g/L glucose, w/o NEAAs DMEM w/o glutamine, with 4.5g/L glucose, w/o NEAAs
Dulbecco's Modified Eagle Medium (DMEM), 4.5g/L glucose, w/o L-Glutamine, w/o non-essentail amino acids, w/o Sodium pyruvate, w/o NaHCO3. Special preparation. Minimum order size: 20 x 500mL. DMEM, intrinsically developed for the...
65,00 € *
DMEM w/o glutamine, w/o amino acids, with 1g/L glucose DMEM w/o glutamine, w/o amino acids, with 1g/L...
Dulbecco's Modified Eagle Medium (DMEM), 1.0g/L glucose, no L-glutamine, no amino acids. Special preparation. Minimal order size: depending on stock at least 3 x 500mL. DMEM, intrinsically developed for the cultivation of murine...
65,00 € *
DMEM w/o glutamine, w/o amino acids, with 4.5g/L glucose DMEM w/o glutamine, w/o amino acids, with...
Dulbecco's Modified Eagle Medium (DMEM), 4.5g/L glucose, no L-glutamine, no amino acids. Special preparation. Minimal order size: 20 x 500mL. DMEM, intrinsically developed for the cultivation of murine embryonic cells, is tailor-made for...
65,00 € *
DMEM w/o glutamine, w/o Arginine, w/o Lysine, w/o glucose, w/o Sodium pyruvate DMEM w/o glutamine, w/o Arginine, w/o Lysine,...
Dulbecco's Modified Eagle Medium (DMEM), no glucose, no glutamine, no lysine, no arginine is a basal cell culture medium for use during SILAC™ protein labeling with stable isotopic labeled lysine and/or arginine. Special preparation....
65,00 € *
DMEM w/o glutamine, w/o Cystine, w/o Methionine, w/o glucose, w/o Sodium pyruvate DMEM w/o glutamine, w/o Cystine, w/o...
Dulbecco's Modified Eagle Medium (DMEM), w/o glucose, no L-glutamine, no L-cysteine, no L-methionine, no Sodium pyruvate. Special preparation. Minimum order size: 20 x 500mL. DMEM, intrinsically developed for the cultivation of murine...
72,00 € *
DMEM w/o L-Cysteine, w/o L-Methionine, w/o L-Glutamine, with 4.5g/L Glucose DMEM w/o L-Cysteine, w/o L-Methionine, w/o...
Dulbecco's Modified Eagle Medium (DMEM), 4.5g/L glucose, no L-cysteine, no L-methionine, no L-glutamine. Special preparation. Minimum order size: 20 x 500mL. DMEM, intrinsically developed for the cultivation of murine embryonic cells, is...
65,00 € *
DMEM medium without L-glutamine DMEM without L-Glutamin, with 1.0g/L Glucose
DMEM without L-Glutamine, with 1.0g/L glucose. Equivalent/alternative to: Biochrom Cat.-no. F 0415, or to Bio&Sell No. BS.F0415. DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal medium for supporting the growth of many...
15,75 € *
DMEM with high Glucose DMEM without L-Glutamin, with 4,5g/L Glucose
DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal medium for supporting the growth of many different mammalian cells. Cells successfully cultured in DMEM include primary fibroblasts, neurons, glial cells, HUVECs, and smooth...
13,39 € *
DMEM w/o L-Glutamine, w/o Ca, with 1g/L Glucose, with Pyruvate DMEM w/o L-Glutamine, w/o Ca, with 1g/L...
Dulbecco's Modified Eagle Medium (DMEM), 1.0g/L glucose, no L-glutamine, no Calcium. Special preparation. Minimum order size: 20 x 500mL. DMEM, intrinsically developed for the cultivation of murine embryonic cells, is tailor-made for the...
65,00 € *
DMEM medium without L-glutamine DMEM without L-Glutamin, with 1.0g/L Glucose
DMEM (low glucose) with stable glutamine (L-alanyl-L-glutamine), with 1.0g/L glucose. Equivalent/alternative to: Biochrom Cat.-no. F 0415, or to Bio&Sell No. BS.F0415. DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal medium...
15,57 € *
DMEM:F12, 1:1 Mix w/o phenol red DMEM:F12, 1:1 Mix w/o phenol red
DMEM:F12, 1:1 Mix with L-Glutamine, without Phenol red, with 1.2g/L NaHCO3. DMEM/F-12 is a 1:1 mixture of Dulbecco's Modified Eagle Medium and Ham's F-12. It combines the high levels of glucose, amino acids and vitamins from DMEM with...
27,50 € *
DMEM:F12, 1:1 Mix with L-Glutamine, with 15mM HEPES DMEM:F12, 1:1 Mix with L-Glutamine, with 15mM...
DMEM:F12, 1:1 Mix with L-Glutamine, with 15mM HEPES, with Phenol red, with 1.2g/L NaHCO3. DMEM/F-12 is a 1:1 mixture of Dulbecco's Modified Eagle Medium and Ham's F-12. It combines the high levels of glucose, amino acids and vitamins...
14,52 € *
DMEM:F12, 1:1 Mix with L-Glutamine, w/o Glucose DMEM:F12, 1:1 Mix with L-Glutamine, w/o Glucose
DMEM:F12, 1:1 Mix with L-Glutamine, with 1.2g/L NaHCO3, without Glucose, without Phenol red. Special preparation. Minium order size: 20 x 500mL. DMEM/F-12 is a 1:1 mixture of Dulbecco's Modified Eagle Medium and Ham's F-12. It combines...
65,00 € *
DMEM:F12, 1:1 Mix with stable glutamine - 500 mL DMEM:F12, 1:1 Mix with stable glutamine - 500 mL
DMEM:F12, 1:1 Mix with stable glutamine, with 1.2g/L NaHCO3. DMEM/F-12 is a 1:1 mixture of Dulbecco's Modified Eagle Medium and Ham's F-12. It combines the high levels of glucose, amino acids and vitamins from DMEM with the various...
15,97 € *
DMEM/F12, 1:1 Mix with stable Glutamine, with Glucose DMEM/F12, 1:1 Mix with stable Glutamine, with...
DMEM:F12, 1:1 Mix with stable Glutamine, with 1.2g/L NaHCO3, with Glucose, without Phenol red. DMEM/F-12 is a 1:1 mixture of Dulbecco's Modified Eagle Medium and Ham's F-12. It combines the high levels of glucose, amino acids and...
13,13 € *
DMEM:F12, 1:1 Mix with stable glutamine, with HEPES - 500 mL DMEM:F12, 1:1 Mix with stable glutamine, with...
DMEM:F12, 1:1 Mix with stable glutamine, with 15mM Hepes buffer, with 4.7g/L NaHCO3. Special preparation. Minium order size: 20 x 500mL. DMEM/F-12 is a 1:1 mixture of Dulbecco's Modified Eagle Medium and Ham's F-12. It combines the high...
65,00 € *
DMEM:F12, 1:1 Mix w/o all amino acids, with Glucose DMEM:F12, 1:1 Mix w/o all amino acids, with...
Microbiological Medium for the cultivation of Borrelia burgdorferi. We will supply each formulation, different from the given. Special preparation. Packsize: min. 20 x 500mL. If you wish, you can choose all incredients as you need...
65,00 € *
DMEM:F12, 1:1 Mix w/o L-Cystine, w/o L-Cysteine hydrochloride, w/o L-Methionine, with Glucose DMEM:F12, 1:1 Mix w/o L-Cystine, w/o L-Cysteine...
DMEM:F12, 1:1 Mix without L-Cystine, without L-Cysteine hydrochloride, without L-Methionine, with Glucose with 4.7g/L NaHCO3, sterile filtered solution for cell culture. Special preparation. Minium order size: 20 x 500mL. DMEM/F-12 is a...
65,00 € *
DMEM:F12, 1:1 Mix with stable glutamine, with HEPES - 500 mL DMEM:F12, 1:1 Mix with stable glutamine, with...
DMEM:F12, 1:1 mixture without L-glutamine, with 15mM Hepes buffer and 1.2/L NaHCO3. Can be supplemented by adding 7% NaHCO3 (> C4213) and/or stable glutamine ( > C4282 ) and thus adapted to the corresponding special applications....
13,34 € *
DMEM:F12, 1:1 Mix w/o L-Glutamine, w/o glucose - 500 mL DMEM:F12, 1:1 Mix w/o L-Glutamine, w/o glucose...
DMEM:F12, 1:1 Mix without Glucose, without L-Glutamine, with 1.2g/L NaHCO3. Special preparation. Minium order size: 20 x 500mL. DMEM/F-12 is a 1:1 mixture of Dulbecco's Modified Eagle Medium and Ham's F-12. It combines the high levels of...
65,00 € *
DMEM:F12, 1:1 Mix w/o L-Methiionine, with HEPES DMEM:F12, 1:1 Mix w/o L-Methiionine, with HEPES
DMEM:F12, 1:1 Mix without L-Methionine, with HEPES, with 1.2g/L NaHCO3, sterile filtered. Special preparation. Minium order size: 20 x 500mL. DMEM/F-12 is a 1:1 mixture of Dulbecco's Modified Eagle Medium and Ham's F-12. It combines the...
65,00 € *
Dimethylsulfoxid chemicals structure DMSO, Molecular biology grade
DMSO is an aprotic polar solvent that is used in chemical reactions as well as in PCR or as anti-freeze protection in the deep-freeze storage of cells, tissues and organs (sterile DMSO only). By adding DMSO for annealing before the...
Gönderen 39,91 € *
DMSO für die Zellkultur - DMSO, Cell culture grade DMSO, Cell culture grade
DMSO is an aprotic polar solvent used in chemical reactions, in PCR and as a cryoprotectant agent for the preservation of cells, tissues and organs. DMSO is used in cell freezing media to protect cells from ice crystal induced mechanical...
Gönderen 39,91 € *
Dimethylsulfoxid chemical structure DMSO, p. A., min. 90%
Dimethyl sulfoxide. Highly active solvent and pharmaceutical vehicle, for freezing cells. For gradient centrifugation. Determination of cysteine and cystine in proteins.
Gönderen 36,52 € *
Loading Dye with Orange G DNA Loading buffer II with Orange G
DNA 6X Loading buffer is a special loading buffer for DNA application on gels that enables viusalization of DNA bands smaller than 100 bp without problems. Buffer contains Glycerol, EDTA, Orange G. The special dye gives the opportunity...
Gönderen 22,05 € *
Loading Dye with Bromophenol blue DNA Loading buffer I
Gel Loading Dye I 6X is a loading buffer for DNA application on gels. Buffer contains Glycerol, EDTA, Bromophenol Blue and Xylene cyanol. Genaxxon 6X DNA Loading Dye is used to prepare DNA markers and samples for loading on agarose or...
Gönderen 22,05 € *
YENİ
Fluorescence Ex/Em spectra of DNA loading buffer I Fluoro bound to DNA DNA Loading buffer I Fluoro (6x)
Loading buffer I Fluoro is a fluorescent reagent that produces instant visualization of DNA bands upon blue light or UV illumination of agarose gels. Supplied in 6X DNA Loading Buffer, Loading buffer I Fluoro is used to prepare DNA...
25,00 € *
1 Gönderen 3
SNP Pol DNA Ova 257-264 Taq DNA Storage Box for DL-Dithiothreit Sodium Penicillin-Stre Agarose LE - hGHRP-2 Human GenLadder 100 Trypsin powder Red MasterMix Collagenase human FSH - GenLadder 100 DNA Loading SafeGel green GelRed in water SafeGel red dNTP Mix Na L-Fucose 5X qPCR DMSO Cell Collagenase D-Lys3 -GHRP-6 rec. GenLadder 1kb Ribonuclease A dNTP-Set Na GreenMasterMix
Bu web sitemizde en iyi deneyimi elde sağlamak için çerezleri kullanır.
Tamam anladım