Peptides & Proteins

... for research on e.g. Covid-19, Alzheimer, Multiple Sclerosis, Apoptosis or Cancer

The current COVID-19 outbreak generates an urgent demand for SARS-CoV-2 related products enabling definition of immune-relevant antigens and identification of B- and T-cell epitopes, development of immune-therapeutic strategies and tools for antigen specific immune monitoring. In response, GENAXXON is offering now a SARS-CoV-2 glycoprotein responsible for membrane fusion and is therefore required for virus entry and cell fusion. 

You can order this protein through our shop: S5340.0100 > 
or request a quote. 
To be able to optimally allocate our capacities, we highly appreciate your feedback on your anticipated needs for larger amounts, or higher purities.

Further information in our flyer >

Peptides and Proteins for research on Covid-19 - Alzheimer - Multiple Sclerosis - Apoptosis - Cancer
GENAXXON bioscience offers peptides from various research areas
as readily available in-stock peptides >

These catalogue peptides come from the research fields: lipopeptides, MHC peptides, MS peptides, Alzheimer peptides / neuroscience, cancer & apoptosis and cell penetrating peptides (CPP).

Of course, we also synthesize peptides on customer request.
As a DIN ISO 9001-2015 certified company, e offer our customers the highest quality in the peptides we supply. The product portfolio includes standard peptides with a purity of 70% to >95% and from 1mg up to 1g, but also isotopic labeled peptides, immunogenic peptides, peptides with post-translational modifications, peptides with a fluorescent label, biotin or other modifications.

For our customers working in the field of Alzheimer´s Disease, Multiple Sclerosis or immunogenic defects , we offer from stock high quality peptides like: Cell Penetrating Peptides >,
MHC-I and MCH-II Peptides >, Peptides for Alzheimer´s Disease > oder or Multiple Sclerosis > research. For details please search our online catalogue.

Besides the above mentioned peptides,GENAXXON offers a wide range of Lipopeptides >, as part of the outer membrane of Gram negative bacteria, Gram positive bacteria and mycoplasma, acting as cell activation signal via toll like receptors are offered by Genaxxon bioscience as purified products that can be ordered from stock.

 

 

... for research on e.g. Covid-19, Alzheimer, Multiple Sclerosis, Apoptosis or Cancer The current COVID-19 outbreak generates an urgent demand for SARS-CoV-2 related products... daha fazla oku »
Pencereyi kapat
Peptides & Proteins

... for research on e.g. Covid-19, Alzheimer, Multiple Sclerosis, Apoptosis or Cancer

The current COVID-19 outbreak generates an urgent demand for SARS-CoV-2 related products enabling definition of immune-relevant antigens and identification of B- and T-cell epitopes, development of immune-therapeutic strategies and tools for antigen specific immune monitoring. In response, GENAXXON is offering now a SARS-CoV-2 glycoprotein responsible for membrane fusion and is therefore required for virus entry and cell fusion. 

You can order this protein through our shop: S5340.0100 > 
or request a quote. 
To be able to optimally allocate our capacities, we highly appreciate your feedback on your anticipated needs for larger amounts, or higher purities.

Further information in our flyer >

Peptides and Proteins for research on Covid-19 - Alzheimer - Multiple Sclerosis - Apoptosis - Cancer
GENAXXON bioscience offers peptides from various research areas
as readily available in-stock peptides >

These catalogue peptides come from the research fields: lipopeptides, MHC peptides, MS peptides, Alzheimer peptides / neuroscience, cancer & apoptosis and cell penetrating peptides (CPP).

Of course, we also synthesize peptides on customer request.
As a DIN ISO 9001-2015 certified company, e offer our customers the highest quality in the peptides we supply. The product portfolio includes standard peptides with a purity of 70% to >95% and from 1mg up to 1g, but also isotopic labeled peptides, immunogenic peptides, peptides with post-translational modifications, peptides with a fluorescent label, biotin or other modifications.

For our customers working in the field of Alzheimer´s Disease, Multiple Sclerosis or immunogenic defects , we offer from stock high quality peptides like: Cell Penetrating Peptides >,
MHC-I and MCH-II Peptides >, Peptides for Alzheimer´s Disease > oder or Multiple Sclerosis > research. For details please search our online catalogue.

Besides the above mentioned peptides,GENAXXON offers a wide range of Lipopeptides >, as part of the outer membrane of Gram negative bacteria, Gram positive bacteria and mycoplasma, acting as cell activation signal via toll like receptors are offered by Genaxxon bioscience as purified products that can be ordered from stock.

 

 

Filtreleri kapat
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
 
gönderen alıcı
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
Filtre için sonuç bulunamadı!
[Ala13] Apelin QRPRLSHKGPMPA [Ala13] Apelin QRPRLSHKGPMPA
Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands,...
Gönderen 140,00 € * 175,00 € *
[Ala9] Autocamtide 2 - KKALRRQEAVDAL [Ala9] Autocamtide 2 - KKALRRQEAVDAL
Gönderen 146,25 € * 195,00 € *
[alpha]-Bag Cell Peptide (1 - 7) - APRLRFY [alpha]-Bag Cell Peptide (1 - 7) - APRLRFY
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia(1). They trigger a series of reproductive behavior in this mollusk that finally culminates in...
Gönderen 100,00 € * 125,00 € *
[alpha]-Bag Cell Peptide (1 - 9) - APRLRFYSL [alpha]-Bag Cell Peptide (1 - 9) - APRLRFYSL
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia(1). They trigger a series of reproductive behavior in this mollusk that finally culminates in...
Gönderen 100,00 € * 125,00 € *
[beta]-Amyloid (10-20) - YEVHHQKLVFF [beta]-Amyloid (10-20) - YEVHHQKLVFF
[beta]-Amyloid (10-20) (peptide sequence: YEVHHQKLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-42 peptide. Amyloid-beta (1-42) human is an Alzheimer desease peptide. Characteristic of Alzheimer...
249,31 € *
[beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS [beta]-Amyloid/A4 Protein Precursor (APP) (328...
Amino acid sequence RERMS represents the active domain of amyloid beta/A4 protein precursor that promotes fibroblast growth; H. Ninomiya, et al.; J. Cell. Biol. 121, 879 (1993). The characteristic of Alzheimer disease is the accumulation...
103,27 € *
[beta]-Bag Cell Peptide - RLRFH [beta]-Bag Cell Peptide - RLRFH
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia(1). They trigger a series of reproductive behavior in this mollusk that finally culminates in...
Gönderen 85,50 € * 90,00 € *
[Des-octanoyl]-Ghrelin, human GSSFLSPEHQRVQQRKESKKPPAKLQPR [Des-octanoyl]-Ghrelin, human...
Ghrelin for engl. Growth Hormone Release Inducing is an appetizing hormone found in the gastric mucosa and the pancreas. In addition to appetite stimulation, the hormone has a number of other effects. Ghrelin is a peptide hormone of 28...
Gönderen 318,25 € * 335,00 € *
[Des-octanoyl]-Ghrelin, rat GSSFLSPEHQKAQQRKESKKPPAKLQPR [Des-octanoyl]-Ghrelin, rat...
Ghrelin for engl. Growth Hormone Release Inducing is an appetizing hormone found in the gastric mucosa and the pancreas. In addition to appetite stimulation, the hormone has a number of other effects. Ghrelin is a peptide hormone of 28...
Gönderen 318,25 € * 335,00 € *
[Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR [Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR
[Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. While the normal peptide does contain a Glycin at position 10 this Glycin...
238,00 € *
[Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV [Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV
[Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV - (HLA-A*02:01) an analog of Melan-A, with Leu substituted for Ala at position 27, shows better HLA-A*0201 binding properties as well as better immunogenicity and antigenicity than the...
Gönderen 74,16 € * 92,70 € *
[Phe17] Apelin KFRRQRPRLSHKGPMPF [Phe17] Apelin KFRRQRPRLSHKGPMPF
Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands,...
Gönderen 226,10 € * 238,00 € *
3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK 3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK
The DYKDDDDK peptide was developed specifically for immunoaffinity chromatography. The peptide allows the competitive elution of proteins (amino terminal, metaminoterminal or carboxy-terminal) FLAG® fusion proteins from anti-FLAG M1 or...
Gönderen 246,13 € * 307,66 € *
Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR
Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically,...
238,00 € *
Ac-KLVFF-NH2 Ac-KLVFF-NH2
Ac-KLVFF-NH2 is the N-terminal and C-terminal modified form of the amyloid-beta (16-20) inhibitor peptid KLVFF. The modification leads to higher stability against peptidases. The KLVFF peptide is one of several inhibitors of amyloid-beta...
Gönderen 163,46 € *
ACTH (1-10), human SYSMEHFRWG ACTH (1-10), human SYSMEHFRWG
ACTH (1-10), human SYSMEHFRWG is a synthetic peptide according to the first 10 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates...
Gönderen 72,00 € * 90,00 € *
ACTH (1-16), human SYSMEHFRWGKPVGKK ACTH (1-16), human SYSMEHFRWGKPVGKK
ACTH (1-16), human SYSMEHFRWGKPVGKK is a synthetic peptide according to the first 16 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it...
238,00 € *
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39), human...
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the first 39 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex....
Gönderen 441,75 € * 465,00 € *
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the amino acids 18 to 39 of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically,...
Gönderen 261,25 € * 275,00 € *
ACTH (4-10), human MEHFRWG ACTH (4-10), human MEHFRWG
ACTH (4-10), human MEHFRWG is a synthetic peptide according to the amino acids 4 to 10 of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates...
Gönderen 85,50 € * 90,00 € *
Albumin from hen egg white - Ovalbumin Albumin from hen egg white - Ovalbumin
Albumin from hen egg white (ovalbumin) is a phosphorylated glycoprotein that contains 385 amino acid residues and has a molecular weight of 42.7 kDa. Chicken egg white is the protein component with the highest amount of egg white. It is...
Gönderen 226,29 € *
alpha-Chymotrypsin (EC 3.4.21.1) alpha-Chymotrypsin (EC 3.4.21.1)
alpha-Chymotrypsin is a serine peptidase that hydrolyzes peptide bonds with aromatic or large hydrophobic side chains (Tyr, Trp, Phe, Leu) on the carboxyl end of the bond. Ca2+ activates and stabilizes the enzyme. The enzyme has 241...
Gönderen 71,15 € *
Amyloid-beta (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Amyloid-beta (1-42), rat...
[beta]-Amyloid (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques...
Gönderen 708,50 € * 745,79 € *
Amyloid-beta (16-20) KLVFF inhibitor peptide of Amyloid-beta Amyloid-beta (16-20) KLVFF inhibitor peptide of...
[beta]-Amyloid (16-20) - KLVFF (peptide sequence: KLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-40 peptide. The KLVFF peptide is one of several inhibitors of amyloid-beta aggregation that have...
103,27 € *
Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ
Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ. Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by...
Gönderen 224,58 € *
Antennapedia (43-58) penetratin Antennapedia (43-58) penetratin
Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable macromolecules, such as peptides, proteins, nucleic acids and nanoparticles. CPPs are usually...
Gönderen 206,00 € * 257,50 € *
Antide Acetate Antide Acetate
Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s body to represses FSH and LH releases that stem from the pituitary gland. Synthetic versions of this chemical have been developed for...
Gönderen 192,33 € *
CD20 188-196 (HLA-A*02:01) HLA-A*02:01 SLFLGILSV CD20 188-196 (HLA-A*02:01) HLA-A*02:01 SLFLGILSV
Gönderen 85,50 € * 90,00 € *
CD22-4 (371-379) HLA-A*02:01 RLLGKESQL CD22-4 (371-379) HLA-A*02:01 RLLGKESQL
Gönderen 85,50 € * 90,00 € *
Chymotrypsinogen A - Chymotrypsin precursor Chymotrypsinogen A - Chymotrypsin precursor
Chymotrypsinogen is the practically inactive "precursor" (proenzyme, or zymogen) of chymotrypsin. In order to be activated, chymotrypsinogen has to be cleaved by trypsin between the amino acids arginine and isoleucine (R15 and I16) ,...
407,31 € *
CMV IE-1 (199-207) - ELRRKMMYM CMV IE-1 (199-207) - ELRRKMMYM
CMV IE-1 ELRRKMMYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in...
Gönderen 72,00 € * 90,00 € *
CMV IE-1 (316-324) (I1) HLA-A*02:01 ILEETSVML CMV IE-1 (316-324) (I1) HLA-A*02:01 ILEETSVML
Antigen peptide IE (316-324) (I1) HLA-A*02:01 (ILEETSVML) for stimulation of antigen-specific T cells in T cell assay such as ELISPOT, ICS, cytotoxicity or proliferation assays. ILEETSVML has an amino acid substitution at position 316...
Gönderen 76,00 € * 95,00 € *
CMV IE-1 (316-324) HLA-A*0201 VLEETSVML CMV IE-1 (316-324) HLA-A*0201 VLEETSVML
CMV IE-1 (316-324) HLA-A * 0201 VLEETSVML for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. IE-1 stands for immediate-early protein 1. CMV stands for human cytomegealovirus, or HCMV for human...
Gönderen 116,00 € * 145,00 € *
CMV IE-1 (99-107) RIKEHMLKK CMV IE-1 (99-107) RIKEHMLKK
IE-1 stands for immediate-early protein 1. CMV stands for human cytomgealovirus, HCMV for human cytomegalovirus or HPV human herpesvirus.
Gönderen 76,00 € * 95,00 € *
CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY
CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von MHC-Klasse-I-Molekülen präsentiert wird.
Gönderen 85,50 € * 90,00 € *
CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK
CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for human cytomegalovirus, or HCMV for human cytomegalovirus or HPV human herpesvirus.
Gönderen 72,00 € * 90,00 € *
CMV pp65 (417-426) HLA-B*07:02 TPRVTGGGAM CMV pp65 (417-426) HLA-B*07:02 TPRVTGGGAM
CMV pp65 (417-426) HLA-B * 07: 02 TPRVTGGGAM for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for human cytomegalovirus, or HCMV for human cytomegalovirus or HPV human herpesvirus.
Gönderen 108,75 € * 145,00 € *
CMV pp65 (417-426), amid HLA-B*07:02 TPRVTGGGAM-NH2 CMV pp65 (417-426), amid HLA-B*07:02...
CMV pp65 (417-426) HLA-B * 07: 02 TPRVTGGGAM for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for human cytomegalovirus, or HCMV for human cytomegalovirus or HPV human herpesvirus.
Gönderen 140,25 € * 165,00 € *
cmv_pp65_495_503_nlvpmvatv CMV pp65 (495-503) HLA-A*02:01 NLVPMVATV
Single peptide (NLVPMVATV) for stimulation of human CMV specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele. Purities offered: >95%. T-cell epitopes are presented on the surface of...
Gönderen 116,00 € * 145,00 € *
Collagenase Type I - with a balanced activity of collagenase, clostripain as well as tryptic and proteolytic activities.es. Collagenase Type I (EC 3.4.24.3) >100 units/mg
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Collagenase type I shows a balanced activity of collagenase, clostripain as well as tryptic and proteolytic...
Gönderen 85,62 € * 122,32 € *
Collagenase Type II - high clostripain activity Collagenase Type II (EC 3.4.24.3) >180 units/mg
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Type II Collagenase is recommended for the preparation of cells from liver, bone, thyroid gland, heart and...
Gönderen 86,32 € * 123,32 € *
Collagenase Type III - normal Collagenase, but very low proteolytic activity Collagenase Type III (EC 3.4.24.3)
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Collagenase type III shows normal Collagenase, but very low proteolytic activity. Type III Collagenase is...
1.405,69 € *
Collagenase IV - low tryptic, high collagenase and normal clostripain activity. Collagenase Type IV (EC 3.4.24.3) >900 units/mg
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Collagenase type IV has low tryptic, high collagenase and normal clostripain activity. Type I Collagenase is...
Gönderen 108,47 € * 135,59 € *
Coronavirus 2019 Nucleocapsid Mosaic Protein Coronavirus 2019 Nucleocapsid Mosaic Protein
The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused to 6xHis tag at C-terminal. The protein is supplied as a sterile filtered clear...
Gönderen 250,64 € *
CyLoP-1 peptide (CRWRWKCCKK) CyLoP-1 peptide (CRWRWKCCKK)
CPPs, such as CyloP-1, are generally taken up by endocytic pathways, with vesicular encapsulation being a limiting factor in intracellular targeting. CyLoP-1 has been developed because it exhibits a pronounced diffuse cytosolic...
Gönderen 144,00 € * 160,00 € *
D-TAT (47-57) ygrkkrrqrrr-NH2 D-TAT (47-57) ygrkkrrqrrr-NH2
Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable macromolecules, such as peptides, proteins, nucleic acids and nanoparticles. CPPs are usually...
Gönderen 296,13 € *
DWGKGGRWRLWPGASGKTEA - Inhibitor Peptide of amyloid-ß DWGKGGRWRLWPGASGKTEA - Inhibitor Peptide of...
The DWGKGGRWRLWPGASGKTEA peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by...
Gönderen 224,54 € *
EBNA-1 Protein (562-570) FMVFLQTHI EBNA-1 Protein (562-570) FMVFLQTHI
The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo virus). On infecting the B-lymphocyte, the linear virus genome circularizes and...
Gönderen 116,00 € * 145,00 € *
EBV BMLF-1 280-288 (HLA-A*02:01) GLCTLVAML EBV BMLF-1 280-288 (HLA-A*02:01) GLCTLVAML
Single peptide (GLCTLVAML) for stimulation of humanEBV BMLF-1(280-288) CD8+ specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele. Purities offered: >95%. T-cell epitopes are presented...
Gönderen 116,00 € * 145,00 € *
EBV BMRF1 (208-216) HLA-A*02:01 TLDYKPLSV EBV BMRF1 (208-216) HLA-A*02:01 TLDYKPLSV
The Epstein–Barr virus (EBV), formally called Human gammaherpesvirus 4, is one of eight known human herpesvirus types in the herpes family, and is one of the most common viruses in humans.
Gönderen 72,00 € * 90,00 € *
EBV EBNA-1 (407-417) HLA-B*35:01 HPVGEADYFEY EBV EBNA-1 (407-417) HLA-B*35:01 HPVGEADYFEY
Gönderen 76,00 € * 95,00 € *
EBV EBNA-3A (325-333) HLA-B*08:01 FLRGRAYGL EBV EBNA-3A (325-333) HLA-B*08:01 FLRGRAYGL
Gönderen 76,00 € * 95,00 € *
EBV EBNA-3A (379-387) HLA-B*07:02 RPPIFIRRL EBV EBNA-3A (379-387) HLA-B*07:02 RPPIFIRRL
Single peptide (RPPIFIRRL) for stimulation of human EBV EBNA-3A (379-387) specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0702 allele. T-cell epitopes are presented on the surface of...
Gönderen 116,00 € * 145,00 € *
EBV LMP-2 (419-427) HLA-A*24:02 TYGPVFMCL EBV LMP-2 (419-427) HLA-A*24:02 TYGPVFMCL
Gönderen 76,00 € * 95,00 € *
EBV LMP2 (131-139) HLA-A*24:02 PYLFWLAAI EBV LMP2 (131-139) HLA-A*24:02 PYLFWLAAI
Gönderen 76,00 € * 95,00 € *
FLAG-Peptide - DYKDDDDK FLAG-Peptide - DYKDDDDK
The DYKDDDDK peptide was specifically designed for immunoaffinity chromatography. It allows elution under mild and non-denaturing conditions. Several antibodies against this peptide have been developed. Usual working concentration is...
Gönderen 140,00 € * 175,00 € *
FYLKVPSSLHHHHGRDKLVFFHHHH FYLKVPSSLHHHHGRDKLVFFHHHH
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
Gönderen 213,89 € *
human growth hormon releasing factor 6 [D-Lys3]-GHRP-6
[D-Lys3]-GHRP6 (growth hormone releasing peptide 6) induces the secretion of growth hormone (GH). In the membrane of clonal GC somatotropes, this peptide elevates the number of functional voltage-gated Ca2+ and Na+ channels. Chronic...
Gönderen 122,94 € * 136,59 € *
P2751 - gp100 (154-162) HLA-A*02:01 KTWGQYWQV gp100 (154-162) HLA-A*02:01 KTWGQYWQV
gp100 (154-162) HLA-A*02:01 KTWGQYWQV is a linear peptidic epitope (epitope ID 33915) studied as part of Melanocyte protein PMEL from Homo sapiens (human). This epitope has been studied for immune reactivity, tested in T cell assays, B...
Gönderen 116,00 € * 145,00 € *
Peptide gp100 (280-288) - Sequence: YLEPGPVTA gp100 (280-288) HLA-A*02:01 YLEPGPVTA
gp100 (280-288) HLA-A*02:01 YLEPGPVTA is a linear peptidic epitope studied as part of Melanocyte protein PMEL from Homo sapiens (human). gp100 peptide YLEPGPVTA (HLA-A*0201) for stimulation of human gp100-specific CD8+ T-cells. The...
Gönderen 78,00 € * 97,50 € *
Growth-hormone-releasing hormone (GHRH) Growth-hormone-releasing hormone (GHRH)
Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or GHRF) or somatocrinin, is a 44-amino acid peptide hormone produced in the arcuate nucleus of the hypothalamus. GHRH is released from...
Gönderen 174,45 € *
HBV core (117-125) (HLA-A*24:02) - EYLVSFGVW HBV core (117-125) (HLA-A*24:02) - EYLVSFGVW
HBV envelope (183-191) (HLA-A*02:01) - FLLTRILTI is a linear peptidic epitope (epitope ID16755) studied as part of Large envelope protein from Hepatitis B virus. This epitope has been studied for immune reactivity. Tested in T cell...
Gönderen 109,13 € * 145,50 € *
HBV core (18-27) (HLA-A*02:01) - FLPSDFFPSV HBV core (18-27) (HLA-A*02:01) - FLPSDFFPSV
HBV core (18-27) (HLA-A*02:01) - FLPSDFFPSV is a linear peptidic epitope studied as part of Capsid protein from Hepatitis B virus and External core antigen from Hepatitis B virus. HBV core peptide FLPSDFFPSV (HLA-A*02:01) for stimulation...
Gönderen 109,13 € * 145,50 € *
HBV core (18-27) (subtype ADR4) (HLA-A*02:01) - FLPSDFFPSI HBV core (18-27) (subtype ADR4) (HLA-A*02:01) -...
HBV core (18-27) (subtype ADR4) (HLA-A*02:01) - FLPSDFFPSI is a linear peptidic epitope (epitope ID16832) studied as part of External core antigen from Hepatitis B virus and Capsid protein from Hepatitis B virus. This epitope has been...
Gönderen 109,13 € * 145,50 € *
HBV core (19-27) (HLA-B*35:01) (HLA-B*51:01) - LPSDFFPSV HBV core (19-27) (HLA-B*35:01) (HLA-B*51:01) -...
HBV core (19-27) (HLA-B*35:01) (HLA-B*51:01) LPSDFFPSV is a linear peptidic epitope (epitope ID38701) studied as part of Large envelope protein from Hepatitis B virus. This epitope has been studied for immune reactivity. Tested in T cell...
Gönderen 109,13 € * 145,50 € *
HBV core antigen (88-96) (HLA-A*11:01) - YVNVNMGLK HBV core antigen (88-96) (HLA-A*11:01) - YVNVNMGLK
HBV core antigen (88-96) (HLA-A*11:01) YVNVNMGLK is a linear peptidic epitope (epitope ID76370) studied as part of Capsid protein from Hepatitis B virus and External core antigen from Hepatitis B virus. This epitope has been studied for...
Gönderen 109,13 € * 145,50 € *
HBV envelope (183-191) (HLA-A*02:01) - FLLTRILTI HBV envelope (183-191) (HLA-A*02:01) - FLLTRILTI
HBV envelope (183-191) (HLA-A*02:01) - FLLTRILTI is a linear peptidic epitope (epitope ID16755) studied as part of Large envelope protein from Hepatitis B virus. This epitope has been studied for immune reactivity. Tested in T cell...
Gönderen 109,13 € * 145,50 € *
HBV envelope (348-357) (HLA-A*02:01) - GLSPTVWLSV HBV envelope (348-357) (HLA-A*02:01) - GLSPTVWLSV
HBV envelope (348-357) (HLA-A*02:01) - GLSPTVWLSV peptide for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.
Gönderen 72,00 € * 90,00 € *
HBV HBsAg (190-197) (H-2 Kb) - VWLSVIWM HBV HBsAg (190-197) (H-2 Kb) - VWLSVIWM
HBV HBsAg (190-197) (H-2 Kb) - VWLSVIWM is a linear peptidic epitope (epitope ID71948) studied as part of Large envelope protein from Hepatitis B virus. This epitope has been studied for immune reactivity, tested in T cell assays and MHC...
Gönderen 72,00 € * 90,00 € *
HBV HBsAg (371-378) (H2-Kb) - IVSPFIPL HBV HBsAg (371-378) (H2-Kb) - IVSPFIPL
HBV HBsAg (371-378) (H2-Kb) - IVSPFIPL is a linear peptidic epitope (epitope ID29454) studied as part of Large envelope protein from Hepatitis B virus. This epitope has been studied for immune reactivity, tested in T cell assays and MHC...
Gönderen 72,00 € * 90,00 € *
HBV Polymerase (455-463) (HLA-A*02:01) - GLSRYVARL HBV Polymerase (455-463) (HLA-A*02:01) - GLSRYVARL
HBV Polymerase (455-463) (HLA-A*02:01) - GLSRYVARL is a linear peptidic epitope (epitope ID21145) studied as part of the Hepatitis B virus polymerase. This epitope has been studied for immune reactivity. Tested in T cell assays, B cell...
Gönderen 109,13 € * 145,50 € *
HCMVA (pp65) Peptide Pool HCMVA (pp65) Peptide Pool
CMV pp65 Control Pool of 138 peptides derived from a peptide scan (15mers with 11 aa overlap) through 65 kDa phosphoprotein (pp65) (UniProtKB - P06725) of Human cytomegalovirus (HHV-5) frequently used as positive control. 15 nmol...
265,00 € *
HCV NS3 (1406-1415) (HLA-A*02:01) KLSGLGINAV HCV NS3 (1406-1415) (HLA-A*02:01) KLSGLGINAV
Gönderen 108,75 € * 145,00 € *
HCV NS5B (2594-2602) HLA-A*02:01 ALYDVVTKL HCV NS5B (2594-2602) HLA-A*02:01 ALYDVVTKL
T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 11 amino acids in length and exhibiting MHC-specific...
Gönderen 123,06 € * 153,83 € *
Heparin sodium salt from porcine intestinal mucosa Heparin sodium salt from porcine intestinal mucosa
Heparin is a polysaccharide classified as mucopolysaccharide or glycosaminoglycan. In the organism, it is especially formed and stored in mast cells of various mammalian tissues such as liver, lung and mucous membrane. Heparin is mainly...
Gönderen 129,07 € *
HER-2/neu (369-377) HLA-A*02:01 KIFGSLAFL HER-2/neu (369-377) HLA-A*02:01 KIFGSLAFL
HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or HER2 / neu. HER2 is a receptor on the surface of cells. Signals are transmitted from the cell surface to the cell nucleus via...
Gönderen 72,00 € * 90,00 € *
HER-2/neu (434-443) HLA-A*02:01 ILHDGAYSL HER-2/neu (434-443) HLA-A*02:01 ILHDGAYSL
HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or HER2 / neu. HER2 is a receptor on the surface of cells. Signals are transmitted from the cell surface to the cell nucleus via...
Gönderen 108,75 € * 145,00 € *
HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL
HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or HER2 / neu. HER2 is a receptor on the surface of cells. Signals are transmitted from the cell surface to the cell nucleus via...
Gönderen 72,00 € * 90,00 € *
HER-2/neu (63-71) HLA-A*24:02 TYLPTNASL HER-2/neu (63-71) HLA-A*24:02 TYLPTNASL
HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or HER2 / neu. HER2 is a receptor on the surface of cells. Signals are transmitted from the cell surface to the cell nucleus via...
Gönderen 72,00 € * 90,00 € *
hGHRP-2 / Human Growth Hormone Releasing Peptide-2 hGHRP-2 / Human Growth Hormone Releasing Peptide-2
Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs to stimulate GH release. GHRP-2, an investigational drug, is one of the most potent...
Gönderen 140,69 € *
Histatin 5 - Sequence: DSHAKRHHGYKRKFHEKHHSHRGY Histatin 5: DSHAKRHHGYKRKFHEKHHSHRGY
Histatin 5 (peptide sequence: DSHAKRHHGYKRKFHEKHHSHRGY) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a broad spectrum antimicrobial activity against bacteria, viruses, and fungi. They are...
Gönderen 225,00 € *
HIV Gag (50-59) HLA-A*02:01 SLFNTVATLY HIV Gag (50-59) HLA-A*02:01 SLFNTVATLY
HIV-1 p17 Gag (77-85) SLYNTVATL belongs to the T-Zell-Epitop-Peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides...
Gönderen 72,00 € * 90,00 € *
HIV Pol HLA-A*02:01 VIYHYVDDL HIV Pol HLA-A*02:01 VIYHYVDDL
Gönderen 108,75 € * 145,00 € *
HIV TAT (48-60) GRKKRRQRRRPPQ-NH2 (amide) HIV TAT (48-60) GRKKRRQRRRPPQ-NH2 (amide)
Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable macromolecules, such as peptides, proteins, nucleic acids and nanoparticles. CPPs are usually...
Gönderen 132,00 € * 165,00 € *
HIV-1 Gag (77-85) HLA-A*02:01 SLFNTVATL HIV-1 Gag (77-85) HLA-A*02:01 SLFNTVATL
HIV-1 Gag (77-85) HLA-A*02:01 SLFNTVATL belongs to the T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically...
Gönderen 72,00 € * 90,00 € *
HIV-1 p17 Gag (77-85) HLA-A*02:01 SLYNTVATL HIV-1 p17 Gag (77-85) HLA-A*02:01 SLYNTVATL
HIV-1 p17 Gag (77-85) SLYNTVATL belongs to the T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides...
Gönderen 116,00 € * 145,00 € *
HIV-1 RT (476-484) HLA-A*02:01 ILKEPVHGV HIV-1 RT (476-484) HLA-A*02:01 ILKEPVHGV
The sequence ILKEPVHGV is part of the Gag-Pol polyprotein from Human immunodeficiency virus 1. The peptide is used for studies on HIV-1 and stimulation of human HIV pol-specific CD8+ T-cells. The peptide is synthesised as it is presented...
Gönderen 108,75 € * 145,00 € *
HIV-1 TAT (47-57) YGRKKRRQRRR-NH2 HIV-1 TAT (47-57) YGRKKRRQRRR-NH2
Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable macromolecules, such as peptides, proteins, nucleic acids and nanoparticles. CPPs are usually...
295,00 € *
HPV 16 E7 (49-57) H-2 Db RAHYNIVTF HPV 16 E7 (49-57) H-2 Db RAHYNIVTF
RAHYNIVTF represents the linear peptidic epitope studied as part of Protein E7 (Alphapapillomavirus 9) and other human papillomavirus protein. This epitope is used to study immune reactivity in, T cell assays, B cell assays and MHC...
Gönderen 108,75 € * 145,00 € *
biotinylated ACE2, Avi-His-tag protein human ACE2 Protein (ECD), Avi/His-Tag,...
Recombinant human ACE2 Protein (ECD processed) contains an Avi/His-Tag, and is biotinylated. We offer high purity. and quality in HEK293 expressed recombinant protein for R&D made in Germany. As SARS-CoV.2 uses ACE2 as the entry point...
1.090,55 € *
tag-free ACE2 - SDS-PAGE Human ACE2 recombinant protein.(ECD,...
Recombinant human ACE2 Protein (ECD processed). We offer high purity. and quality in HEK293 expressed recombinant protein for R&D made in Germany. As SARS-CoV.2 uses ACE2 as the entry point into cells it is one of the most important...
722,95 € *
human FSH - Follicle stimulating Hormone human FSH - Follicle stimulating Hormone
Follicle stimulating hormone (FSH) is a hormone synthesised and secreted by gonadotropes in the anterior pituitary gland. FSH and LH act synergistically in reproduction in women, in the ovary FSH stimulates the growth of immature...
Gönderen 153,83 € *
human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
LL-37 human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
Gönderen 241,40 € * 284,00 € *
human LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES human LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 human LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
Gönderen 252,49 € * 315,62 € *
Hyaluronidase (EC 3.2.1.35) - min. 500 U/mg Hyaluronidase (EC 3.2.1.35) - min. 500 U/mg
Hyaluronidase isolated from sheep testes. The mammalian glycolytic hyaluronidase (EC 3.2.1.35) catalyzes the hydrolysis of the 1-4 bond between N-acetyl-D-glucosamine and D-glucuronic acid in hyaluronic acid. It also hydrolyses...
262,65 € *
Indolicidin - ILPWKWPWWPWRR-NH2 Indolicidin - ILPWKWPWWPWRR-NH2
Indolicidin (peptide sequence: ILPWKWPWWPWRR-NH2) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a broad spectrum antimicrobial activity against bacteria, viruses, and fungi. They are...
Gönderen 235,00 € *
P2277 - Influenza A MP (58-66) HLA-A*02:01 GILGFVFTL Influenza A MP (58-66) HLA-A*02:01 GILGFVFTL
Influenza A MP (58-66) HLA-A*02:01 GILGFVFTL. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 11 amino...
Gönderen 116,00 € * 145,00 € *
Influenza A NP (366-374) - ASNENMETM Influenza A NP (366-374) - ASNENMETM
Influenza A NP (366-374) - ASNENMETM. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 11 amino acids in...
Gönderen 116,00 € * 145,00 € *
Control peptide Amyloid-beta (40-1) human Control peptide Amyloid-beta (40-1) human
Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly....
Gönderen 260,71 € *
Control peptide Amyloid-beta (40-1) rat Control peptide Amyloid-beta (40-1) rat
Control peptide Amyloid-beta (40-1) rat. Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble...
Gönderen 260,71 € *
LCVM GP (33-41) peptide sequence LCMV GP (33-41) KAVYNFATM
LCMV GP (33-41) with the peptide sequence KAVYNFATM is a T-cell epitope peptide which is normally presented presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are...
Gönderen 116,00 € * 145,00 € *
LH - Luteinizing Hormone from procine LH - Luteinizing Hormone from procine
Porcine Luteinizing Hormone is a glycosylated, polypeptide chain which stimulates maturation of follicle, induces ovulation, accelerates formation of corpus luteum and secretion of pregnanolone. Porcine Luteinizing Hormone delays ovulation.
Gönderen 122,00 € *
Lysozym from Genaxxon Lysozyme from chicken egg, ca. 20000 U/mg
The enzyme Lysozyme (Muramidase) affects the cell walls of bacteria. Thereby the extraction efficiency of proteins or nucleic acids is significantly improved. Genaxxon Lysozyme from chicken egg is available as lyophilized powder....
Gönderen 76,31 € *
MAGE-A3 (112-120) HLA-A*02:01 KVAEELVHFL - alternative sequence MAGE-A3 (112-120) HLA-A*02:01 KVAEELVHFL -...
MAGE-A3 (112-120) HLA-A*02:01 KVAEELVHFL belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are...
Gönderen 80,63 € * 100,79 € *
MAGE-A3 (112-120) HLA-A*02:01 KVAELVHFL MAGE-A3 (112-120) HLA-A*02:01 KVAELVHFL
MAGE-A3 (112-120) HLA-A*02:01 KVAELVHFL belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are...
Gönderen 76,00 € * 95,00 € *
MAGE-A3 (271-279) HLA-A*02:01 FLWGPRALV MAGE-A3 (271-279) HLA-A*02:01 FLWGPRALV
MAGE-A3 (271-279) HLA-A*02:01 FLWGPRALV antigen belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I...
Gönderen 116,00 € * 145,00 € *
MAGE-A3 Peptide Pool MAGE-A3 Peptide Pool
MAGE-A3 Control Pool of 76peptides derived from a peptide scan (15mers with 11 aa overlap) through Melanoma-associated antigen 3 (MAGEA3) (UniProt ID: P43357) of Homo sapiens (Human) for T cell assay. Length of Melanoma-associated...
225,00 € *
MAGE-A4 (230–239) HLA-A*02:01 GVYDGREHTV MAGE-A4 (230–239) HLA-A*02:01 GVYDGREHTV
MAGE-A4 (230–239) HLA-A*02:01 GVYDGREHTV belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are...
Gönderen 80,63 € * 100,79 € *
MBP (1-11) human - Ac-ASQKRPSQRHG MBP (1-11) human - Ac-ASQKRPSQRHG
MBP (1-11) human - ASQKRPSQRHG represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an autoimmune...
Gönderen 116,00 € * 145,00 € *
MBP (54-72) human - SHHAARTTHYGSLPQKSQR MBP (54-72) human - SHHAARTTHYGSLPQKSQR
MBP (54-72) human - SHHAARTTHYGSLPQKSQR represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an...
Gönderen 232,00 € * 290,00 € *
melan_a_mart_1_26_35_eaagigiltv Melan-A / MART-1 (26-35) EAAGIGILTV - A*02:01
Melan-A / MART-1 (26-35) EAAGIGILTV - A*02:01 belongs to a group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules...
Gönderen 116,00 € * 145,00 € *
Melan-A / MART-1 (26-35) - EAAGIGILTY - B*35:01 Melan-A / MART-1 (26-35) - EAAGIGILTY - B*35:01
Melan-A / MART-1 (26-35) EAAGIGILTV - A*02:01 belongs to a group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules...
Gönderen 80,00 € * 100,00 € *
MOG (183-191) FVIVPVLGP MOG (183-191) FVIVPVLGP
MOG (183-191) FVIVPVLGP represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an autoimmune disease...
Gönderen 116,00 € * 145,00 € *
MOG (35-55) human - MEVGWYRPPFSRVVHLYRNGK MOG (35-55) human - MEVGWYRPPFSRVVHLYRNGK
The MOG peptide fragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) induces experimental autoimmune encephalomyelitis in rodents. A single injection of this peptide produces a relapsing-remitting neurologic...
Gönderen 178,23 € * 222,79 € *
MOG (35-55) Ratte/Maus MEVGWYRSPFSRVVHLYRNGK MOG (35-55) rat/mouse MEVGWYRSPFSRVVHLYRNGK
The MOG peptide fragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) induces experimental autoimmune encephalomyelitis in rodents. A single injection of this peptide produces a relapsing-remitting neurologic...
Gönderen 168,00 € * 210,00 € *
MOG (35-55) Rat/Mouse MEVGWYRSPFSRVVHLYRNGK MOG (35-55) rat/mouse MEVGWYRSPFSRVVHLYRNGK -...
The MOG peptide fragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) induces experimental autoimmune encephalomyelitis in rodents. A single injection of this peptide produces a relapsing-remitting neurologic...
Gönderen 374,63 € * 405,00 € *
MOG (91-108), rat SDEGGYTCFFRDHSYQEE MOG (91-108), rat SDEGGYTCFFRDHSYQEE
MOG (91-108) SDEGGYTCFFRDHSYQEE represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an autoimmune...
Gönderen 232,00 € * 290,00 € *
MOG (92-106) DEGGYTCFFRDHSYQ MOG (92-106) DEGGYTCFFRDHSYQ
MOG (92-106) DEGGYTCFFRDHSYQ represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an autoimmune...
Gönderen 168,00 € * 210,00 € *
MOG (97-108) TCFFRDHSYQEE MOG (97-108) TCFFRDHSYQEE
MOG (97-108) TCFFRDHSYQEE represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an autoimmune disease...
Gönderen 168,00 € * 210,00 € *
Lysozym from Genaxxon Lysozyme from chicken egg white, min. 20000...
Lysozyme (Muramidase) preferentially hydrolyses the β-1,4-glycosidic binding between N-Acetyl muraminic acid and N-Acetyl glucosamine, a component of the proteoglycan-cell wall of certain microorganisms. The enzyme is present in many...
Gönderen 45,32 € *
MUC-1 (12-20) HLA-A*02:01 LLLLTVLTV MUC-1 (12-20) HLA-A*02:01 LLLLTVLTV
MUC-1 (12-20) HLA-A*02:01 LLLLTVLTV belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are...
Gönderen 93,43 € * 98,35 € *
MUC-1 (13-21) HLA-A*02:01 LLLTVLTVV MUC-1 (13-21) HLA-A*02:01 LLLTVLTVV
MUC-1 (13-21) HLA-A*02:01 LLLTVLTVV belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are...
Gönderen 93,43 € * 98,35 € *
Nona arginine - Arg9 (R9) Nona arginine - Arg9 (R9)
Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable macromolecules, such as peptides, proteins, nucleic acids and nanoparticles. CPPs are usually...
Gönderen 116,00 € * 145,00 € *
D-Arg9 (r9) - Nona-D-Arginine D-Arg9 (r9) - Nona-D-Arginine
Nona-D-Arginine (r9, respective sequence: rrrrrrrrr) belongs to the group of cell penetrating peptide (CPPs) which are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable...
Gönderen 311,25 € *
D-Arg9 (r9) - Nona-D-Arginine amidated C-terminus D-Arg9 (r9) - Nona-D-Arginine amidated C-terminus
Nona-D-Arginine (r9, respective sequence: rrrrrrrrr-NH2) belongs to the group of cell penetrating peptide (CPPs) which are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable...
Gönderen 287,79 € *
D-Arg9 (r9) - Nona-D-Arginine modified termini D-Arg9 (r9) - Nona-D-Arginine modified termini
Nona-D-Arginine (r9, respective sequence: Ac-rrrrrrrrr-NH2) belongs to the group of cell penetrating peptide (CPPs) which are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable...
Gönderen 287,79 € *
P2275 Ova (257-264) peptide SIINFEKL free acid Ova (257-264) SIINFEKL
Ovalbumin (257-264) chicken has been used to trigger T cell activation in immunology studies. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules...
Gönderen 116,00 € * 145,00 € *
P3286 Ova (257-264) peptide SIINFEKL amide Ova (257-264) SIINFEKL amide
Ovalbumin (257-264) chicken has been used to trigger T cell activation in immunology studies. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules...
Gönderen 116,00 € * 145,00 € *
Ova (323-339) Homologe - ISQAVHAARAEINEAGR-NH2 (Amide) Ova (323-339) Homologe - ISQAVHAARAEINEAGR-NH2...
T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 11 amino acids in length and exhibiting MHC-specific...
Gönderen 116,70 € *
P2283_ova_323_339_peptide Ova (323-339) ISQAVHAAHAEINEAGR
T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 11 amino acids in length and exhibiting MHC-specific...
Gönderen 148,53 € * 185,66 € *
Ova (323-339) ISQAVHAAHAEINEAGR-NH2 (Amide) Ova (323-339) ISQAVHAAHAEINEAGR-NH2 (Amide)
T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 11 amino acids in length and exhibiting MHC-specific...
Gönderen 111,24 € * 139,05 € *
Ovalbumin (crude) Ovalbumin (crude)
Albumin from chicken egg (Ovalbumin). Crude: min. 80% protein.
Gönderen 79,57 € *
p53 (264-272) HLA-A*0201 LLGRNSFEV p53 (264-272) HLA-A*0201 LLGRNSFEV
Tumor protein p53, also known as p53, cellular tumor antigen p53 (UniProt name), phosphoprotein p53, tumor suppressor p53, antigen NY-CO-13, or transformation-related protein 53 (TRP53), is any isoform of a protein encoded by homologous...
Gönderen 108,75 € * 145,00 € *
p53 (264-272) HLA-A*0201 LLGRNSFEV p53 (264-272) HLA-A*0201 LLGRNSFEV
Tumor protein p53, also known as p53, cellular tumor antigen p53 (UniProt name), phosphoprotein p53, tumor suppressor p53, antigen NY-CO-13, or transformation-related protein 53 (TRP53), is any isoform of a protein encoded by homologous...
Gönderen 108,75 € * 145,00 € *
PADRE - AKFVAAWTLKAAA PADRE - AKFVAAWTLKAAA
The pan HLA DR-binding epitope (PADRE) has been proposed as a simple carrier epitope suitable for use in the development of synthetic and recombinant vaccines. T cell epitopes are presented on the surface of antigen-presenting cells by...
Gönderen 148,53 € * 185,66 € *
Pancreatin Pancreatin
Pancreatin is an complex enzymatic mixture of active ingredients that are obtained from the pancreas of domestic pigs.
Gönderen 49,97 € *
Papain from Carica papaya Papain from Carica papaya
Papain is a member of the class of proteolytic enzymes that needs a free sulfhydryl group for activity (group of the cysteine proteases). The pH optimum of Papain is approx. pH 6 and the optimum temperature for activity is 65°C. At the...
67,00 € *
Pepsin from Genaxxon Pepsin (EC 3.4.23.1)
Pepsin from pig stomach. Its inactive precursor is the pepsinogen secreted by the main cells of the gastric mucosa. Pepsinogen is cleaved at acidic pH below 3 into the proteolytically active pepsin. Pepsin is one of the important...
Gönderen 53,79 € *
Alzheimer Peptide NYSKMIFSHHHH Peptide: NYSKMIFSHHHH
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
Gönderen 163,46 € *
PLP (139-151) - HCLGKWLGHPDKF PLP (139-151) - HCLGKWLGHPDKF
PLP (139 - 151) - HCLGKWLGHPDKF represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an autoimmune...
Gönderen 160,68 € * 200,85 € *
PLP (178-191) - NTWTTCQSIAFPSK PLP (178-191) - NTWTTCQSIAFPSK
PLP (178-191) - NTWTTCQSIAFPSK represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense system in multiple sclerosis. Multiple sclerosis (MS), an...
Gönderen 148,00 € * 185,00 € *
PRAME (100-108) HLA-A*0201 VLDGLDVLL PRAME (100-108) HLA-A*0201 VLDGLDVLL
PRAME (100-108) HLA-A*0201 VLDGLDVLL for stimulation of human Prame (100-108) specific CD8+ T cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allel.
Gönderen 108,75 € * 145,00 € *
PRAME (301-309) HLA-A24 LYVDSLFFL PRAME (301-309) HLA-A24 LYVDSLFFL
Gönderen 108,75 € * 145,00 € *
recombinant Lysostaphin - Glycyl-glycine Endopeptidase recombinant Lysostaphin - EC 3.4.24.75
Lysostaphin, an endopeptidase specific for the cell wall peptidoglycan of staphylococci, is an extremely potent anti-staphylococcal agent. Lysostaphin is used as a research and diagnostic tool. Because it lyses staphylococci efficiently,...
Gönderen 180,25 € *
rec. Human Serum Albumin (rHSA) rec. Human Serum Albumin (rHSA)
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
Gönderen 583,50 € *
rec. Human Serum Albumin (rHSA) - from rice grain rec. Human Serum Albumin (rHSA) - from rice grain
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
Gönderen 382,13 € *
rec. Human Serum Albumin (rHSA) - lipid-free rec. Human Serum Albumin (rHSA) - lipid-free
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
Gönderen 249,31 € *
rec. L-Asparaginase rec. L-Asparaginase
L-Asparaginase is an enzyme that depletes L-Asparagine an important nutrient for cancer cells resulting in cancer/tumor cell starvation. L-asparaginase is an anti-tumor agent derived from E.coli., which can inhibit the growth of...
Gönderen 201,96 € *
non-biotinylated ACE2 Avi-His-tagged - SDS-PAGE recombinant human ACE2 Protein (ECD),...
Recombinant human ACE2 Protein (ECD processed) contains an Avi/His-Tag, and is ready for invitro biotinylation. We offer high purity. and quality in HEK293 expressed recombinant protein for R&D made in Germany. As SARS-CoV.2 uses ACE2 as...
722,95 € *
RHAMM (165-173) HLA-A*0201 ILSLELMKL RHAMM (165-173) HLA-A*0201 ILSLELMKL
RHAMM peptide ILSLELMKL (HLA-A*0201) for stimulation of human RHAMM -specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele.
Gönderen 108,75 € * 145,00 € *
rhCG - Corticotropin releasing hormone binding protein rhCG - Corticotropin releasing hormone binding...
CRH is a powerful stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. CRH concentration in the human peripheral circulation is usually low. The concentration rises during pregnancy and fall back quickly after...
Gönderen 140,69 € *
rHu EpCAM - 100 µg rHu EpCAM - 100 µg
Epithelial Cell Adhesion Molecule (EpCAM) also known as antigen GA733-2 is a 40 kDa transmembrane glycoprotein . It´s composed of a 242 aa extracellular domain (ED), a 23 aa transmembrane region and a 26 aa cytoplasmatic region. EpCAM is...
525,00 € *
rHu HER2-ECD / ErbB2/Her2 rHu HER2-ECD / ErbB2/Her2
HER2/neu/ErbB-2 (human epidermal growth factor receptor 2) is a membrane glycoprotein of the ErbB family of tyrosine kinase receptors. This protein family members (ErbB1-4) serve as receptors for epidermal growth factor. ErbB2 is found...
618,33 € *
rHu Vitronectin rHu Vitronectin
Vitronectin is a multifunctional glycoprotein present in blood and in the extra-cellular matrix. It is an important participant in a large variety of biological functions. These include cell attachment, spreading, migration, blood...
Gönderen 246,49 € *
rhuPTH - recombinant human Parathyroid Hormon (aa 1-34) rhuPTH - recombinant human Parathyroid Hormon...
Synonyms: Parathyrin, PTH, Parathormone. Rec. Parathyroid Hormone Human (C181H290N55O51S2) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 34 amino acids and having a molecular mass of 4117.8 Dalton.
Gönderen 318,80 € *
RIIGL - Inhibitor Peptide of amyloid-ß RIIGL - Inhibitor Peptide of amyloid-ß
RIIGL is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches....
Gönderen 163,20 € *
Bovine Serum Albumin, very low endotoxin, no IgG Bovine Serum Albumin, very low endotoxin, no IgG
Heat treated (equivalent to 10 hours at 60°C). IgG not detectable. Free of mycoplasma and bovine viruses. Free from capryllic acid or other stabilisers that could be cytotoxic to some cell lines. Tested for use in tissue culture.
Gönderen 86,05 € *
Bovine albumin for EIA and RIA Bovine albumin for EIA and RIA
IgG-free bovine serum albumin. Especially recommended as a blocking and stabilising reagent in all antibody-mediated detection systems. In addition to being IgG-free, this albumin also shows a very low fatty acid content of less than...
Gönderen 61,54 € *
Bovine albumin crystallized, free of fatty acid, free of globulin Bovine albumin crystallized, free of fatty...
Albumin - crystallised is a Fraction V Albumin recrystallised 3 times at temperatures below 0°C. This procedure ensures a very native protein, that is free of carbohydrates, globulines and fatty-acids.
Gönderen 112,88 € *
Bovine albumin Fraction V (pH 7.0) Bovine albumin Fraction V (pH 7.0)
Standard grade, lyophilised Albumin. Bovine serum albumin (BSA) is added as a stabilizing component for proteins/enzymes to several enzyme reaction and storage buffers. The concentration usually ranges from 0.01% (0.1mg/mL) to 3%...
Gönderen 73,13 € *
RSV NP (137-145) HLA-A*02:01 KMLKEMGEV RSV NP (137-145) HLA-A*02:01 KMLKEMGEV
RSV NP (137-145) HLA-A*02:01 KMLKEMGEV is a linear peptidic epitope (epitope ID32357) studied as part of Nucleoprotein from Human respiratory syncytial virus. This epitope has been studied for immune reactivity, tested in T cell assays...
Gönderen 108,75 € * 145,00 € *
SARS-CoV SSp-1 A2 (HLA-A*02:01) - RLNEVAKNL SARS-CoV SSp-1 A2 (HLA-A*02:01) - RLNEVAKNL
SARS-CoV-2 Nucleocapsid A2 peptide RLNEVAKNL of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation SARS-CoV-2 immune...
Gönderen 106,25 € * 125,00 € *
Trimeric SARS-CoV-2 S Protein - SDS PAGEsars cov_2 trimeric_sds SARS-CoV-2 (2019-nCoV) Spike S1 Protein,...
The engineered recombinant Sars-Co-V-2 Spike S1 protein contains specific amino acid substitutions to stabilize the prefusion conformation (2P). Furthermore, the furin cleavage site at the boundary between the S1/S2 subunits was deleted...
588,16 € *
SARS-CoV-2 (2019-nCoV) Nucleocapsidprotein (1-419) - SDS-PAGE SARS-CoV-2 (COVID-19) Nucleocapsidprotein -...
Beneath the envelope membrane, the coronavirus SARS-CoV-2 shows an icosahedral nucleocapsid that contains the genetic information in form of positive sensed single-stranded RNA. RNA and a phosphorylated nucleocapsid protein do form a...
513,71 € *
SARS-CoV-2 (N-Protein) - Peptide Pool SARS-CoV-2 (N-Protein) - Peptide Pool
Peptide pool of 102 overlapping peptides of the Nucleoprotein of SARS-CoV-2. The peptide pools is derived from a peptide scan (15mers with 11 aa overlap - UniProt: P0DTC9) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related...
262,65 € *
SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200)
SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli . The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.) immunodominant regions, fused to 6xHis tag at C-terminal.
Gönderen 250,64 € *
SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) SARS-CoV-2 Coronavirus 2019 Spike (800 -1000)
SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli . The protein contains the Coronavirus 2019 Spike (800-1000 a.a.) immunodominant regions, fused to 6xHis tag at C-terminal.
Gönderen 250,64 € *
SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic - with His-Tag SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic -...
SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and envelope (E) immunodominant regions, fused to a C-terminal His-tag. The supplied...
Gönderen 250,64 € *
SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag at C-terminal. The nCoV-S1 protein is supplied as sterile filtered clear 1X DPBS...
Gönderen 1.108,38 € *
SARS-CoV-2 Membrane GP A2 (61-70) TLACFVLAAV SARS-CoV-2 Membrane GP A2 (61-70) TLACFVLAAV
SARS-CoV-2 Membrane GP A2 TLACFVLAAV with amino acids 61-70 of the Membrane GP A2 protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation...
Gönderen 106,25 € * 125,00 € *
SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike...
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc tag at C-terminal. The nCoV-S2 protein is supplied as sterile filtered clear 1X...
Gönderen 1.108,38 € *
SARS-CoV-2 Nucleocapsid _1 B7 FPRGQGVPI SARS-CoV-2 Nucleocapsid _1 B7 FPRGQGVPI
SARS-CoV-2 Nucleocapsid _1 B7 FPRGQGVPI is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation SARS-CoV-2 immune monitoring (Covid19 immune...
Gönderen 106,25 € * 125,00 € *
SARS-CoV-2 Nucleocapsid _2 B7 SPRWYFYYL SARS-CoV-2 Nucleocapsid _2 B7 SPRWYFYYL
SARS-CoV-2 Nucleocapsid _2 B7 SPRWYFYYL is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation SARS-CoV-2 immune monitoring (Covid19 immune...
Gönderen 106,25 € * 125,00 € *
SARS-CoV-2 Nucleocapsid _3 B7 KPRQKRTAT SARS-CoV-2 Nucleocapsid _3 B7 KPRQKRTAT
SARS-CoV-2 Nucleocapsid _3 B7 KPRQKRTAT is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation SARS-CoV-2 immune monitoring (Covid19 immune...
Gönderen 106,25 € * 125,00 € *
SARS-CoV-2 Nucleocapsid A2 (138-146) - ALNTPKDHI SARS-CoV-2 Nucleocapsid A2 (138-146) - ALNTPKDHI
SARS-CoV-2 Nucleocapsid A2 peptide ALNTPKDHI with amino acids 138-146 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell...
Gönderen 106,25 € * 125,00 € *
SARS-CoV-2 Nucleocapsid A2 (219-227) LQLPQGTTL SARS-CoV-2 Nucleocapsid A2 (219-227) LQLPQGTTL
SARS-CoV-2 Nucleocapsid A2 peptide LQLPQGTTL with amino acids 219-227 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell...
Gönderen 106,25 € * 125,00 € *
SARS-CoV-2 Nucleocapsid A2 (226-234) LALLLLDRL SARS-CoV-2 Nucleocapsid A2 (226-234) LALLLLDRL
SARS-CoV-2 Nucleocapsid A2 peptide LALLLLDRL with amino acids 226-234 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell...
Gönderen 106,25 € * 125,00 € *
SARS-CoV-2 Nucleocapsid A2 (316-324) GMSRIGMEV SARS-CoV-2 Nucleocapsid A2 (316-324) GMSRIGMEV
SARS-CoV-2 Nucleocapsid A2 peptide GMSRIGMEV with amino acids 316-324 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell...
Gönderen 106,25 € * 125,00 € *
SARS-CoV-2 Nucleocapsid A2 (N223-231) LLLDRLNQL SARS-CoV-2 Nucleocapsid A2 (N223-231) LLLDRLNQL
SARS-CoV-2 Nucleocapsid A2 peptide LLLDRLNQLwith amino acids N223-231 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell...
Gönderen 106,25 € * 125,00 € *
SARS-CoV-2 (2019-nCoV) Spike S1 Protein (RBD) - SDS-PAGE SARS-CoV-2 Spike S1 Protein (RBD) - without Tag
SARS-CoV-2 Spike Protein RBD Recombinant without His-tag is a recombinant protein that is in liquid form buffered in PBS. This protein was produced recombinantly and is HIS-tagged at the C-terminus. This receptor binding domain (RBD) of...
304,62 € *
SARS-CoV-2 (2019-nCoV) Spike S1 protein (RBD) - SDS-PAGE SARS-CoV-2 Spike S1 Protein (RBD) mit His-Tag
SARS-CoV-2 Spike Protein RBD Recombinant with C-terminal His-tag is a recombinant protein that is in liquid form buffered in PBS. This protein was produced recombinantly and is HIS-tagged at the C-terminus.This receptor binding domain...
384,31 € *
SARS-CoV-2 Surface GP A2 (1000-1008) - YLQPRTFLL SARS-CoV-2 Surface GP A2 (1000-1008) - YLQPRTFLL
SARS-CoV-2 Surface A2 peptide with amino acids YLQPRTFLL of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation...
Gönderen 131,25 € * 175,00 € *
SARS-CoV-2 Surface GP_1 A1 (865-873) - LTDEMIAQY SARS-CoV-2 Surface GP_1 A1 (865-873) - LTDEMIAQY
SARS-CoV-2 Nucleocapsid A1 peptide with amino acids LTDEMIAQY of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation...
Gönderen 106,25 € * 125,00 € *
SARS-CoV-2 Surface GP_1 A3 (378-386) - KCYGVSPTK SARS-CoV-2 Surface GP_1 A3 (378-386) - KCYGVSPTK
SARS-CoV-2 Nucleocapsid KCYGVSPTK with amino acids 138-146 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation...
Gönderen 285,00 € *
SART3 (309-317) HLA-A*02:01 RLAEYQAYI SART3 (309-317) HLA-A*02:01 RLAEYQAYI
Gönderen 108,75 € * 145,00 € *
Serratia Nuclease - 100000 IU Serratia Nuclease - 100000 IU
Serratia nuclease is a non-specific enzyme that cleaves all forms of DNA and RNA very efficiently. It is commonly used on biological material for the quantitative removal of nucleic acids and for viscosity reduction. The nuclease can be...
656,84 € *
TEV Protease TEV Protease from Tobacco Etch Virus - min. 95%...
TEV-protease is a highly site-specific cysteine protease that is found in the Tobacco Etch Virus (TEV). The Genaxon TEV protease comes with an N-terminal His-tag for simple removal from the cleavage reaction by immobilization on...
Gönderen 179,93 € *
Trypsin from bovine pancreas Trypsin from bovine pancreas
Trypsin from bovine pancreas, Tryptic activity (BAEE): min. 2500 U/mg. Lyophilised. No P. aeruginosa, Salmonella, Staphyloccus aureus detectable. Activity: 1g of Trypsin digests 250g of Casein substrate. Synonym: Peptidylpeptid-Hydrolase...
358,00 € *
Trypsin from porcine pancreas Trypsin powder from porcine pancreas (1:250)
Trypsin 1:250 from porcine pancreas (240 - 260 USP U/mg). Contains Chymotrypsin, Elastase and other non proteolytic activities. The native form of Trypsin consists of a single chain polypeptide of 223 amino acid residues, produced by the...
Gönderen 128,87 € *
Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV
Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV for stimulation of T-cells. The single peptide (YMDGTMSQV) is used for stimulation of human gp100-specific CD8+ T-cells.
Gönderen 108,75 € * 145,00 € *
Tyrosinase (425-434) HLA-A*03:01 YMVPFIPLYR Tyrosinase (425-434) HLA-A*03:01 YMVPFIPLYR
The similar peptide Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV (P3175 >) for stimulation of T-cells. The single peptide (YMDGTMSQV) is used for stimulation of human gp100-specific CD8+ T-cells.
Gönderen 108,75 € * 145,00 € *
Variant B.1.617.2 (Delta) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) Variant B.1.617.2 (Delta) Peptide Pool...
The Variant B.1.617.2 (Delta) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) with 27 peptides covers all mutations in the Spike Glycoprotein derived from the delta variant B.1.617.2 of SARS-CoV-2 which is prevalent in India and carries the...
262,65 € *
Zymolyase Zymolyase(R) -100T
Zymolyase®, produced by a submerged culture of Arthrobacter luteus , has strong lytic activity against living yeast cell walls to produce protoplast or spheroplast of various strains of yeast cells. An essential enzyme for the lytic...
802,15 € *
Zymolyase Zymolyase(R) -20T
Zymolyase®, produced by a submerged culture of Arthrobacter luteus , has strong lytic activity against living yeast cell walls to produce protoplast or spheroplast of various strains of yeast cells. An essential enzyme for the lytic...
Gönderen 297,41 € *
α-Defensin 5 human - ATCYCRTGRCATRESLSGVCEISGRLYRLCCR α-Defensin 5 human -...
α-Defensin 5 (peptide sequence: ATCYCRTGRCATRESLSGVCEISGRLYRLCCR) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a broad spectrum antimicrobial activity against bacteria, viruses, and fungi....
720,00 € *