Filtre için sonuç bulunamadı!
![[Ala13] Apelin QRPRLSHKGPMPA [Ala13] Apelin QRPRLSHKGPMPA](/themes/Frontend/Responsive/frontend/_public/src/img/no-picture.jpg)
Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands,...
Gönderen 140,00 € * 175,00 € *
![[alpha]-Bag Cell Peptide (1 - 7) - APRLRFY [alpha]-Bag Cell Peptide (1 - 7) - APRLRFY](/themes/Frontend/Responsive/frontend/_public/src/img/no-picture.jpg)
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia(1). They trigger a series of reproductive behavior in this mollusk that finally culminates in...
Gönderen 100,00 € * 125,00 € *
![[alpha]-Bag Cell Peptide (1 - 9) - APRLRFYSL [alpha]-Bag Cell Peptide (1 - 9) - APRLRFYSL](/themes/Frontend/Responsive/frontend/_public/src/img/no-picture.jpg)
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia(1). They trigger a series of reproductive behavior in this mollusk that finally culminates in...
Gönderen 100,00 € * 125,00 € *
![[beta]-Amyloid (10-20) - YEVHHQKLVFF [beta]-Amyloid (10-20) - YEVHHQKLVFF](/themes/Frontend/Responsive/frontend/_public/src/img/no-picture.jpg)
[beta]-Amyloid (10-20) (peptide sequence: YEVHHQKLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-42 peptide. Amyloid-beta (1-42) human is an Alzheimer desease peptide. Characteristic of Alzheimer...
242,05 € *
![[beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS [beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS](/themes/Frontend/Responsive/frontend/_public/src/img/no-picture.jpg)
Amino acid sequence RERMS represents the active domain of amyloid beta/A4 protein precursor that promotes fibroblast growth; H. Ninomiya, et al.; J. Cell. Biol. 121, 879 (1993). The characteristic of Alzheimer disease is the accumulation...
100,26 € *
![[beta]-Bag Cell Peptide - RLRFH [beta]-Bag Cell Peptide - RLRFH](/themes/Frontend/Responsive/frontend/_public/src/img/no-picture.jpg)
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia(1). They trigger a series of reproductive behavior in this mollusk that finally culminates in...
Gönderen 85,50 € * 90,00 € *
![[Des-octanoyl]-Ghrelin, human GSSFLSPEHQRVQQRKESKKPPAKLQPR [Des-octanoyl]-Ghrelin, human GSSFLSPEHQRVQQRKESKKPPAKLQPR](/themes/Frontend/Responsive/frontend/_public/src/img/no-picture.jpg)
Ghrelin for engl. Growth Hormone Release Inducing is an appetizing hormone found in the gastric mucosa and the pancreas. In addition to appetite stimulation, the hormone has a number of other effects. Ghrelin is a peptide hormone of 28...
Gönderen 318,25 € * 335,00 € *
![[Des-octanoyl]-Ghrelin, rat GSSFLSPEHQKAQQRKESKKPPAKLQPR [Des-octanoyl]-Ghrelin, rat GSSFLSPEHQKAQQRKESKKPPAKLQPR](/themes/Frontend/Responsive/frontend/_public/src/img/no-picture.jpg)
Ghrelin for engl. Growth Hormone Release Inducing is an appetizing hormone found in the gastric mucosa and the pancreas. In addition to appetite stimulation, the hormone has a number of other effects. Ghrelin is a peptide hormone of 28...
Gönderen 318,25 € * 335,00 € *
![[Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR [Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR](/themes/Frontend/Responsive/frontend/_public/src/img/no-picture.jpg)
[Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. While the normal peptide does contain a Glycin at position 10 this Glycin...
238,00 € *
![[Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV [Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV](/themes/Frontend/Responsive/frontend/_public/src/img/no-picture.jpg)
[Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV - (HLA-A*02:01) an analog of Melan-A, with Leu substituted for Ala at position 27, shows better HLA-A*0201 binding properties as well as better immunogenicity and antigenicity than the...
Gönderen 74,16 € * 92,70 € *
![[Phe17] Apelin KFRRQRPRLSHKGPMPF [Phe17] Apelin KFRRQRPRLSHKGPMPF](/themes/Frontend/Responsive/frontend/_public/src/img/no-picture.jpg)
Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands,...
Gönderen 226,10 € * 238,00 € *

The DYKDDDDK peptide was developed specifically for immunoaffinity chromatography. The peptide allows the competitive elution of proteins (amino terminal, metaminoterminal or carboxy-terminal) FLAG® fusion proteins from anti-FLAG M1 or...
Gönderen 238,96 € * 298,70 € *

Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically,...
238,00 € *

Ac-KLVFF-NH2 is the N-terminal and C-terminal modified form of the amyloid-beta (16-20) inhibitor peptid KLVFF. The modification leads to higher stability against peptidases. The KLVFF peptide is one of several inhibitors of amyloid-beta...
Gönderen 158,70 € *

ACTH (1-10), human SYSMEHFRWG is a synthetic peptide according to the first 10 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates...
Gönderen 72,00 € * 90,00 € *

ACTH (1-16), human SYSMEHFRWGKPVGKK is a synthetic peptide according to the first 16 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it...
238,00 € *

ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the first 39 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex....
Gönderen 441,75 € * 465,00 € *

ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the amino acids 18 to 39 of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically,...
Gönderen 261,25 € * 275,00 € *

ACTH (4-10), human MEHFRWG is a synthetic peptide according to the amino acids 4 to 10 of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates...
Gönderen 85,50 € * 90,00 € *

Albumin from hen egg white (ovalbumin) is a phosphorylated glycoprotein that contains 385 amino acid residues and has a molecular weight of 42.7 kDa. Chicken egg white is the protein component with the highest amount of egg white. It is...
Gönderen 226,29 € *

alpha-Chymotrypsin is a serine peptidase that hydrolyzes peptide bonds with aromatic or large hydrophobic side chains (Tyr, Trp, Phe, Leu) on the carboxyl end of the bond. Ca2+ activates and stabilizes the enzyme. The enzyme has 241...
Gönderen 69,08 € *

[beta]-Amyloid (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques...
Gönderen 687,86 € * 724,07 € *

[beta]-Amyloid (16-20) - KLVFF (peptide sequence: KLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-40 peptide. The KLVFF peptide is one of several inhibitors of amyloid-beta aggregation that have...
100,26 € *

Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ. Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by...
Gönderen 218,04 € *

Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable macromolecules, such as peptides, proteins, nucleic acids and nanoparticles. CPPs are usually...
Gönderen 200,00 € * 250,00 € *

Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s body to represses FSH and LH releases that stem from the pituitary gland. Synthetic versions of this chemical have been developed for...
Gönderen 186,73 € *

Chymotrypsinogen is the practically inactive "precursor" (proenzyme, or zymogen) of chymotrypsin. In order to be activated, chymotrypsinogen has to be cleaved by trypsin between the amino acids arginine and isoleucine (R15 and I16) ,...
395,45 € *

CMV IE-1 ELRRKMMYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in...
Gönderen 72,00 € * 90,00 € *

Antigen peptide IE (316-324) (I1) HLA-A*02:01 (ILEETSVML) for stimulation of antigen-specific T cells in T cell assay such as ELISPOT, ICS, cytotoxicity or proliferation assays. ILEETSVML has an amino acid substitution at position 316...
Gönderen 76,00 € * 95,00 € *

CMV IE-1 (316-324) HLA-A * 0201 VLEETSVML for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. IE-1 stands for immediate-early protein 1. CMV stands for human cytomegealovirus, or HCMV for human...
Gönderen 116,00 € * 145,00 € *

IE-1 stands for immediate-early protein 1. CMV stands for human cytomgealovirus, HCMV for human cytomegalovirus or HPV human herpesvirus.
Gönderen 76,00 € * 95,00 € *

CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von MHC-Klasse-I-Molekülen präsentiert wird.
Gönderen 85,50 € * 90,00 € *

CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for human cytomegalovirus, or HCMV for human cytomegalovirus or HPV human herpesvirus.
Gönderen 72,00 € * 90,00 € *

CMV pp65 (417-426) HLA-B * 07: 02 TPRVTGGGAM for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for human cytomegalovirus, or HCMV for human cytomegalovirus or HPV human herpesvirus.
Gönderen 108,75 € * 145,00 € *

CMV pp65 (417-426) HLA-B * 07: 02 TPRVTGGGAM for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for human cytomegalovirus, or HCMV for human cytomegalovirus or HPV human herpesvirus.
Gönderen 140,25 € * 165,00 € *
Single peptide (NLVPMVATV) for stimulation of human CMV specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele. Purities offered: >95%. T-cell epitopes are presented on the surface of...
Gönderen 116,00 € * 145,00 € *
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Collagenase type I shows a balanced activity of collagenase, clostripain as well as tryptic and proteolytic...
Gönderen 79,94 € * 114,20 € *
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Type II Collagenase is recommended for the preparation of cells from liver, bone, thyroid gland, heart and...
Gönderen 79,94 € * 114,20 € *
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Collagenase type III shows normal Collagenase, but very low proteolytic activity. Type III Collagenase is...
1.364,75 € *
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Collagenase type IV has low tryptic, high collagenase and normal clostripain activity. Type I Collagenase is...
Gönderen 100,00 € * 125,00 € *
Concanavalin A is a member of a group of proteins called lectins which are proteins that react with specific sugar residues. It has broad applicability and is the most widely used lectin within molecular biology research. The...
Gönderen 87,75 € *

The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused to 6xHis tag at C-terminal. The protein is supplied as a sterile filtered clear...
Gönderen 243,34 € *

CPPs, such as CyloP-1, are generally taken up by endocytic pathways, with vesicular encapsulation being a limiting factor in intracellular targeting. CyLoP-1 has been developed because it exhibits a pronounced diffuse cytosolic...
Gönderen 144,00 € * 160,00 € *

Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable macromolecules, such as peptides, proteins, nucleic acids and nanoparticles. CPPs are usually...
Gönderen 287,50 € *

Dermcidin-1L (DCD-1) is a 47-amino acid antimicrobial peptide (AMP). It is expressed in eccrine sweat glands, secreted into sweat at a concentration of 1-10µg/mL, and transported to the epidermal surface. Unlike most AMPs, which are...
Gönderen 850,00 € *

Dermcidin-1L (DCD-1L) is a 48-amino acid antimicrobial peptide (AMP) with a Leu residue on the C-terminus. It is expressed in eccrine sweat glands, secreted into sweat at a concentration of 1-10µg/mL, and transported to the epidermal...
Gönderen 925,00 € *

The DWGKGGRWRLWPGASGKTEA peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by...
Gönderen 218,00 € *

The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo virus). On infecting the B-lymphocyte, the linear virus genome circularizes and...
Gönderen 116,00 € * 145,00 € *

Single peptide (GLCTLVAML) for stimulation of humanEBV BMLF-1(280-288) CD8+ specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele. Purities offered: >95%. T-cell epitopes are presented...
Gönderen 116,00 € * 145,00 € *

The Epstein–Barr virus (EBV), formally called Human gammaherpesvirus 4, is one of eight known human herpesvirus types in the herpes family, and is one of the most common viruses in humans.
Gönderen 72,00 € * 90,00 € *

Single peptide (RPPIFIRRL) for stimulation of human EBV EBNA-3A (379-387) specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0702 allele. T-cell epitopes are presented on the surface of...
Gönderen 116,00 € * 145,00 € *

Peptide pool with 14 peptides that covers all mutations in the Spike Glycoprotein derived from the epsilon variant B.1.427/B.1.429 of SARS-CoV-2. Possilbe applications: T-cell assays, Immune monitoring, Antigen specific T-cell...
262,65 € *

This peptide pool with 31 peptides covers all mutations in the Spike Glycoprotein derived from the eta variant B.1.525 of SARS-CoV-2 which emerged in Angola in December 2020.. Possilbe applications: T-cell assays, Immune monitoring,...
262,65 € *

The DYKDDDDK peptide was specifically designed for immunoaffinity chromatography. It allows elution under mild and non-denaturing conditions. Several antibodies against this peptide have been developed. Usual working concentration is...
Gönderen 140,00 € * 175,00 € *

Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
Gönderen 207,66 € *
[D-Lys3]-GHRP6 (growth hormone releasing peptide 6) induces the secretion of growth hormone (GH). In the membrane of clonal GC somatotropes, this peptide elevates the number of functional voltage-gated Ca2+ and Na+ channels. Chronic...
Gönderen 119,36 € * 132,61 € *
gp100 (154-162) HLA-A*02:01 KTWGQYWQV is a linear peptidic epitope (epitope ID 33915) studied as part of Melanocyte protein PMEL from Homo sapiens (human). This epitope has been studied for immune reactivity, tested in T cell assays, B...
Gönderen 116,00 € * 145,00 € *
gp100 (280-288) HLA-A*02:01 YLEPGPVTA is a linear peptidic epitope studied as part of Melanocyte protein PMEL from Homo sapiens (human). gp100 peptide YLEPGPVTA (HLA-A*0201) for stimulation of human gp100-specific CD8+ T-cells. The...
Gönderen 78,00 € * 97,50 € *

Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or GHRF) or somatocrinin, is a 44-amino acid peptide hormone produced in the arcuate nucleus of the hypothalamus. GHRH is released from...
Gönderen 169,37 € *

HBV envelope (183-191) (HLA-A*02:01) - FLLTRILTI is a linear peptidic epitope (epitope ID16755) studied as part of Large envelope protein from Hepatitis B virus. This epitope has been studied for immune reactivity. Tested in T cell...
Gönderen 108,75 € * 145,00 € *

HBV core (18-27) (HLA-A*02:01) - FLPSDFFPSV is a linear peptidic epitope studied as part of Capsid protein from Hepatitis B virus and External core antigen from Hepatitis B virus. HBV core peptide FLPSDFFPSV (HLA-A*02:01) for stimulation...
Gönderen 108,75 € * 145,00 € *

HBV core (18-27) (subtype ADR4) (HLA-A*02:01) - FLPSDFFPSI is a linear peptidic epitope (epitope ID16832) studied as part of External core antigen from Hepatitis B virus and Capsid protein from Hepatitis B virus. This epitope has been...
Gönderen 108,75 € * 145,00 € *

HBV core (19-27) (HLA-B*35:01) (HLA-B*51:01) LPSDFFPSV is a linear peptidic epitope (epitope ID38701) studied as part of Large envelope protein from Hepatitis B virus. This epitope has been studied for immune reactivity. Tested in T cell...
Gönderen 108,75 € * 145,00 € *

HBV core antigen (88-96) (HLA-A*11:01) YVNVNMGLK is a linear peptidic epitope (epitope ID76370) studied as part of Capsid protein from Hepatitis B virus and External core antigen from Hepatitis B virus. This epitope has been studied for...
Gönderen 108,75 € * 145,00 € *

HBV envelope (183-191) (HLA-A*02:01) - FLLTRILTI is a linear peptidic epitope (epitope ID16755) studied as part of Large envelope protein from Hepatitis B virus. This epitope has been studied for immune reactivity. Tested in T cell...
Gönderen 108,75 € * 145,00 € *

HBV envelope (348-357) (HLA-A*02:01) - GLSPTVWLSV peptide for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.
Gönderen 72,00 € * 90,00 € *

HBV HBsAg (190-197) (H-2 Kb) - VWLSVIWM is a linear peptidic epitope (epitope ID71948) studied as part of Large envelope protein from Hepatitis B virus. This epitope has been studied for immune reactivity, tested in T cell assays and MHC...
Gönderen 72,00 € * 90,00 € *

HBV HBsAg (371-378) (H2-Kb) - IVSPFIPL is a linear peptidic epitope (epitope ID29454) studied as part of Large envelope protein from Hepatitis B virus. This epitope has been studied for immune reactivity, tested in T cell assays and MHC...
Gönderen 72,00 € * 90,00 € *

CMV pp65 Control Pool of 138 peptides derived from a peptide scan (15mers with 11 aa overlap) through 65 kDa phosphoprotein (pp65) (UniProtKB - P06725) of Human cytomegalovirus (HHV-5) frequently used as positive control. 15 nmol...
265,00 € *

T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 11 amino acids in length and exhibiting MHC-specific...
Gönderen 119,48 € * 149,35 € *

Heparin is a polysaccharide classified as mucopolysaccharide or glycosaminoglycan. In the organism, it is especially formed and stored in mast cells of various mammalian tissues such as liver, lung and mucous membrane. Heparin is mainly...
Gönderen 125,31 € *

HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or HER2 / neu. HER2 is a receptor on the surface of cells. Signals are transmitted from the cell surface to the cell nucleus via...
Gönderen 72,00 € * 90,00 € *

HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or HER2 / neu. HER2 is a receptor on the surface of cells. Signals are transmitted from the cell surface to the cell nucleus via...
Gönderen 108,75 € * 145,00 € *

HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or HER2 / neu. HER2 is a receptor on the surface of cells. Signals are transmitted from the cell surface to the cell nucleus via...
Gönderen 72,00 € * 90,00 € *

HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or HER2 / neu. HER2 is a receptor on the surface of cells. Signals are transmitted from the cell surface to the cell nucleus via...
Gönderen 72,00 € * 90,00 € *

Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs to stimulate GH release. GHRP-2, an investigational drug, is one of the most potent...
Gönderen 136,59 € *
Histatin 5 (peptide sequence: DSHAKRHHGYKRKFHEKHHSHRGY) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a broad spectrum antimicrobial activity against bacteria, viruses, and fungi. They are...
Gönderen 225,00 € *

HIV-1 p17 Gag (77-85) SLYNTVATL belongs to the T-Zell-Epitop-Peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides...
Gönderen 72,00 € * 90,00 € *

Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable macromolecules, such as peptides, proteins, nucleic acids and nanoparticles. CPPs are usually...
Gönderen 132,00 € * 165,00 € *

HIV-1 Gag (77-85) HLA-A*02:01 SLFNTVATL belongs to the T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically...
Gönderen 72,00 € * 90,00 € *

HIV-1 p17 Gag (77-85) SLYNTVATL belongs to the T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides...
Gönderen 116,00 € * 145,00 € *

The sequence ILKEPVHGV is part of the Gag-Pol polyprotein from Human immunodeficiency virus 1. The peptide is used for studies on HIV-1 and stimulation of human HIV pol-specific CD8+ T-cells. The peptide is synthesised as it is presented...
Gönderen 108,75 € * 145,00 € *

Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable macromolecules, such as peptides, proteins, nucleic acids and nanoparticles. CPPs are usually...
295,00 € *

RAHYNIVTF represents the linear peptidic epitope studied as part of Protein E7 (Alphapapillomavirus 9) and other human papillomavirus protein. This epitope is used to study immune reactivity in, T cell assays, B cell assays and MHC...
Gönderen 108,75 € * 145,00 € *
Recombinant human ACE2 Protein (ECD processed) contains an Avi/His-Tag, and is biotinylated. We offer high purity. and quality in HEK293 expressed recombinant protein for R&D made in Germany. As SARS-CoV.2 uses ACE2 as the entry point...
1.058,79 € *
Recombinant human ACE2 Protein (ECD processed). We offer high purity. and quality in HEK293 expressed recombinant protein for R&D made in Germany. As SARS-CoV.2 uses ACE2 as the entry point into cells it is one of the most important...
701,89 € *

Follicle stimulating hormone (FSH) is a hormone synthesised and secreted by gonadotropes in the anterior pituitary gland. FSH and LH act synergistically in reproduction in women, in the ovary FSH stimulates the growth of immature...
Gönderen 149,35 € *

LL-37 human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
Gönderen 241,40 € * 284,00 € *

LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
Gönderen 245,14 € * 306,43 € *

Hyaluronidase isolated from sheep testes. The mammalian glycolytic hyaluronidase (EC 3.2.1.35) catalyzes the hydrolysis of the 1-4 bond between N-acetyl-D-glucosamine and D-glucuronic acid in hyaluronic acid. It also hydrolyses...
255,00 € *

Indolicidin (peptide sequence: ILPWKWPWWPWRR-NH2) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a broad spectrum antimicrobial activity against bacteria, viruses, and fungi. They are...
Gönderen 235,00 € *
Influenza A MP (58-66) HLA-A*02:01 GILGFVFTL. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 11 amino...
Gönderen 116,00 € * 145,00 € *

Influenza A NP (366-374) - ASNENMETM. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 11 amino acids in...
Gönderen 116,00 € * 145,00 € *

Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly....
Gönderen 253,11 € *

Control peptide Amyloid-beta (40-1) rat. Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble...
Gönderen 253,11 € *
LCMV GP (33-41) with the peptide sequence KAVYNFATM is a T-cell epitope peptide which is normally presented presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are...
Gönderen 119,48 € * 149,35 € *

Porcine Luteinizing Hormone is a glycosylated, polypeptide chain which stimulates maturation of follicle, induces ovulation, accelerates formation of corpus luteum and secretion of pregnanolone. Porcine Luteinizing Hormone delays ovulation.
Gönderen 118,45 € *
The enzyme Lysozyme (Muramidase) affects the cell walls of bacteria. Thereby the extraction efficiency of proteins or nucleic acids is significantly improved. Genaxxon Lysozyme from chicken egg is available as lyophilized powder....
Gönderen 74,09 € *

MAGE-A3 (112-120) HLA-A*02:01 KVAEELVHFL belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are...
Gönderen 78,28 € * 97,85 € *

MAGE-A3 (112-120) HLA-A*02:01 KVAELVHFL belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are...
Gönderen 76,00 € * 95,00 € *

MAGE-A3 (271-279) HLA-A*02:01 FLWGPRALV antigen belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I...
Gönderen 116,00 € * 145,00 € *

MAGE-A3 Control Pool of 76peptides derived from a peptide scan (15mers with 11 aa overlap) through Melanoma-associated antigen 3 (MAGEA3) (UniProt ID: P43357) of Homo sapiens (Human) for T cell assay. Length of Melanoma-associated...
225,00 € *

MAGE-A4 (230–239) HLA-A*02:01 GVYDGREHTV belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are...
Gönderen 78,28 € * 97,85 € *

MBP (1-11) human - ASQKRPSQRHG represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an autoimmune...
Gönderen 116,00 € * 145,00 € *

MBP (54-72) human - SHHAARTTHYGSLPQKSQR represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an...
Gönderen 232,00 € * 290,00 € *
Melan-A / MART-1 (26-35) EAAGIGILTV - A*02:01 belongs to a group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules...
Gönderen 116,00 € * 145,00 € *

Melan-A / MART-1 (26-35) EAAGIGILTV - A*02:01 belongs to a group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules...
Gönderen 80,00 € * 100,00 € *

MOG (183-191) FVIVPVLGP represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an autoimmune disease...
Gönderen 116,00 € * 145,00 € *

The MOG peptide fragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) induces experimental autoimmune encephalomyelitis in rodents. A single injection of this peptide produces a relapsing-remitting neurologic...
Gönderen 173,04 € * 216,30 € *
The MOG peptide fragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) induces experimental autoimmune encephalomyelitis in rodents. A single injection of this peptide produces a relapsing-remitting neurologic...
Gönderen 168,00 € * 210,00 € *
The MOG peptide fragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) induces experimental autoimmune encephalomyelitis in rodents. A single injection of this peptide produces a relapsing-remitting neurologic...
Gönderen 374,63 € * 405,00 € *

MOG (91-108) SDEGGYTCFFRDHSYQEE represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an autoimmune...
Gönderen 232,00 € * 290,00 € *

MOG (92-106) DEGGYTCFFRDHSYQ represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an autoimmune...
Gönderen 168,00 € * 210,00 € *

MOG (97-108) TCFFRDHSYQEE represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an autoimmune disease...
Gönderen 168,00 € * 210,00 € *
Lysozyme (Muramidase) preferentially hydrolyses the β-1,4-glycosidic binding between N-Acetyl muraminic acid and N-Acetyl glucosamine, a component of the proteoglycan-cell wall of certain microorganisms. The enzyme is present in many...
Gönderen 44,00 € *

MUC-1 (12-20) HLA-A*02:01 LLLLTVLTV belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are...
Gönderen 90,71 € * 95,48 € *

MUC-1 (13-21) HLA-A*02:01 LLLTVLTVV belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are...
Gönderen 90,71 € * 95,48 € *

Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable macromolecules, such as peptides, proteins, nucleic acids and nanoparticles. CPPs are usually...
Gönderen 116,00 € * 145,00 € *

Nona-D-Arginine (r9, respective sequence: rrrrrrrrr) belongs to the group of cell penetrating peptide (CPPs) which are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable...
Gönderen 302,18 € *

Nona-D-Arginine (r9, respective sequence: rrrrrrrrr-NH2) belongs to the group of cell penetrating peptide (CPPs) which are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable...
Gönderen 279,41 € *

Nona-D-Arginine (r9, respective sequence: Ac-rrrrrrrrr-NH2) belongs to the group of cell penetrating peptide (CPPs) which are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable...
Gönderen 279,41 € *
Ovalbumin (257-264) chicken has been used to trigger T cell activation in immunology studies. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules...
Gönderen 92,00 € * 115,00 € *
Ovalbumin (257-264) chicken has been used to trigger T cell activation in immunology studies. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules...
Gönderen 92,00 € * 115,00 € *

T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 11 amino acids in length and exhibiting MHC-specific...
Gönderen 113,30 € *
T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 11 amino acids in length and exhibiting MHC-specific...
Gönderen 144,20 € * 180,25 € *

T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 11 amino acids in length and exhibiting MHC-specific...
Gönderen 108,00 € * 135,00 € *

Tumor protein p53, also known as p53, cellular tumor antigen p53 (UniProt name), phosphoprotein p53, tumor suppressor p53, antigen NY-CO-13, or transformation-related protein 53 (TRP53), is any isoform of a protein encoded by homologous...
Gönderen 108,75 € * 145,00 € *

Tumor protein p53, also known as p53, cellular tumor antigen p53 (UniProt name), phosphoprotein p53, tumor suppressor p53, antigen NY-CO-13, or transformation-related protein 53 (TRP53), is any isoform of a protein encoded by homologous...
Gönderen 108,75 € * 145,00 € *

The pan HLA DR-binding epitope (PADRE) has been proposed as a simple carrier epitope suitable for use in the development of synthetic and recombinant vaccines. T cell epitopes are presented on the surface of antigen-presenting cells by...
Gönderen 144,20 € * 180,25 € *

Pancreatin is an complex enzymatic mixture of active ingredients that are obtained from the pancreas of domestic pigs.
Gönderen 48,51 € *

Papain is a member of the class of proteolytic enzymes that needs a free sulfhydryl group for activity (group of the cysteine proteases). The pH optimum of Papain is approx. pH 6 and the optimum temperature for activity is 65°C. At the...
65,04 € *
Pepsin from pig stomach. Its inactive precursor is the pepsinogen secreted by the main cells of the gastric mucosa. Pepsinogen is cleaved at acidic pH below 3 into the proteolytically active pepsin. Pepsin is one of the important...
Gönderen 52,22 € *
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
Gönderen 158,70 € *

PLP (139 - 151) - HCLGKWLGHPDKF represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense in multiple sclerosis. Multiple sclerosis (MS), an autoimmune...
Gönderen 156,00 € * 195,00 € *

PLP (178-191) - NTWTTCQSIAFPSK represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune defense system in multiple sclerosis. Multiple sclerosis (MS), an...
Gönderen 148,00 € * 185,00 € *

PRAME (100-108) HLA-A*0201 VLDGLDVLL for stimulation of human Prame (100-108) specific CD8+ T cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allel.
Gönderen 108,75 € * 145,00 € *
Lysostaphin, an endopeptidase specific for the cell wall peptidoglycan of staphylococci, is an extremely potent anti-staphylococcal agent. Lysostaphin is used as a research and diagnostic tool. Because it lyses staphylococci efficiently,...
Gönderen 175,00 € *

Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
Gönderen 566,50 € *

Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
Gönderen 371,00 € *

Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
Gönderen 242,05 € *
L-Asparaginase is an enzyme that depletes L-Asparagine an important nutrient for cancer cells resulting in cancer/tumor cell starvation. L-asparaginase is an anti-tumor agent derived from E.coli., which can inhibit the growth of...
Gönderen 196,08 € *
Recombinant human ACE2 Protein (ECD processed) contains an Avi/His-Tag, and is ready for invitro biotinylation. We offer high purity. and quality in HEK293 expressed recombinant protein for R&D made in Germany. As SARS-CoV.2 uses ACE2 as...
701,89 € *

RHAMM peptide ILSLELMKL (HLA-A*0201) for stimulation of human RHAMM -specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele.
Gönderen 108,75 € * 145,00 € *

CRH is a powerful stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. CRH concentration in the human peripheral circulation is usually low. The concentration rises during pregnancy and fall back quickly after...
Gönderen 136,59 € *

Epithelial Cell Adhesion Molecule (EpCAM) also known as antigen GA733-2 is a 40 kDa transmembrane glycoprotein . It´s composed of a 242 aa extracellular domain (ED), a 23 aa transmembrane region and a 26 aa cytoplasmatic region. EpCAM is...
525,00 € *

HER2/neu/ErbB-2 (human epidermal growth factor receptor 2) is a membrane glycoprotein of the ErbB family of tyrosine kinase receptors. This protein family members (ErbB1-4) serve as receptors for epidermal growth factor. ErbB2 is found...
618,33 € *

Vitronectin is a multifunctional glycoprotein present in blood and in the extra-cellular matrix. It is an important participant in a large variety of biological functions. These include cell attachment, spreading, migration, blood...
Gönderen 234,75 € *

Synonyms: Parathyrin, PTH, Parathormone. Rec. Parathyroid Hormone Human (C181H290N55O51S2) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 34 amino acids and having a molecular mass of 4117.8 Dalton.
Gönderen 309,52 € *

RIIGL is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches....
Gönderen 158,44 € *

Heat treated (equivalent to 10 hours at 60°C). IgG not detectable. Free of mycoplasma and bovine viruses. Free from capryllic acid or other stabilisers that could be cytotoxic to some cell lines. Tested for use in tissue culture.
Gönderen 83,54 € *

The manufacturing process uses acetic anhydride and chaotropic agents which destroy nucleases and proteases commonly found in BSA. Genaxxon bioscience acetylated albumin is thus specially recommended for all molecular biology applications.
Gönderen 151,74 € *

IgG-free bovine serum albumin. Especially recommended as a blocking and stabilising reagent in all antibody-mediated detection systems. In addition to being IgG-free, this albumin also shows a very low fatty acid content of less than...
Gönderen 59,75 € *

Albumin - crystallised is a Fraction V Albumin recrystallised 3 times at temperatures below 0°C. This procedure ensures a very native protein, that is free of carbohydrates, globulines and fatty-acids.
Gönderen 109,59 € *

Standard grade, lyophilised Albumin. Bovine serum albumin (BSA) is added as a stabilizing component for proteins/enzymes to several enzyme reaction and storage buffers. The concentration usually ranges from 0.01% (0.1mg/mL) to 3%...
Gönderen 71,00 € *

RSV NP (137-145) HLA-A*02:01 KMLKEMGEV is a linear peptidic epitope (epitope ID32357) studied as part of Nucleoprotein from Human respiratory syncytial virus. This epitope has been studied for immune reactivity, tested in T cell assays...
Gönderen 108,75 € * 145,00 € *

SARS-CoV-2 Nucleocapsid A2 peptide RLNEVAKNL of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation SARS-CoV-2 immune...
Gönderen 106,25 € * 125,00 € *
The engineered recombinant Sars-Co-V-2 Spike S1 protein contains specific amino acid substitutions to stabilize the prefusion conformation (2P). Furthermore, the furin cleavage site at the boundary between the S1/S2 subunits was deleted...
571,03 € *
Beneath the envelope membrane, the coronavirus SARS-CoV-2 shows an icosahedral nucleocapsid that contains the genetic information in form of positive sensed single-stranded RNA. RNA and a phosphorylated nucleocapsid protein do form a...
513,71 € *

Peptide pool of 102 overlapping peptides of the Nucleoprotein of SARS-CoV-2. The peptide pools is derived from a peptide scan (15mers with 11 aa overlap - UniProt: P0DTC9) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related...
262,65 € *

SARS-CoV-2 (Spike Glycoprotein) Peptide Pool of 316 overlapping peptides (delivered in two subpools of 158 & 158 peptides) derived from a peptide scan (15mers with 11 aa overlap) through Spike glycoprotein (UniProt: P0DTC2) of SARS-CoV-2...
592,25 € *

SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli . The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.) immunodominant regions, fused to 6xHis tag at C-terminal.
Gönderen 243,34 € *

SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain is derived as a recombinant protein from E.Coli . The protein contains the Coronavirus 2019 Spike Receptor Binding Domain (300-600 a.a.) immunodominant region, fused to...
Gönderen 243,34 € *

SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli . The protein contains the Coronavirus 2019 Spike (800-1000 a.a.) immunodominant regions, fused to 6xHis tag at C-terminal.
Gönderen 243,34 € *

SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and envelope (E) immunodominant regions, fused to a C-terminal His-tag. The supplied...
Gönderen 243,34 € *

The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag at C-terminal. The nCoV-S1 protein is supplied as sterile filtered clear 1X DPBS...
Gönderen 1.076,09 € *

SARS-CoV-2 Membrane GP A2 TLACFVLAAV with amino acids 61-70 of the Membrane GP A2 protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation...
Gönderen 106,25 € * 125,00 € *

The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc tag at C-terminal. The nCoV-S2 protein is supplied as sterile filtered clear 1X...
Gönderen 1.076,09 € *

SARS-CoV-2 Nucleocapsid _1 B7 FPRGQGVPI is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation SARS-CoV-2 immune monitoring (Covid19 immune...
Gönderen 106,25 € * 125,00 € *

SARS-CoV-2 Nucleocapsid _2 B7 SPRWYFYYL is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation SARS-CoV-2 immune monitoring (Covid19 immune...
Gönderen 106,25 € * 125,00 € *

SARS-CoV-2 Nucleocapsid _3 B7 KPRQKRTAT is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation SARS-CoV-2 immune monitoring (Covid19 immune...
Gönderen 106,25 € * 125,00 € *

SARS-CoV-2 Nucleocapsid A2 peptide ALNTPKDHI with amino acids 138-146 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell...
Gönderen 106,25 € * 125,00 € *

SARS-CoV-2 Nucleocapsid A2 peptide LQLPQGTTL with amino acids 219-227 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell...
Gönderen 106,25 € * 125,00 € *

SARS-CoV-2 Nucleocapsid A2 peptide LALLLLDRL with amino acids 226-234 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell...
Gönderen 106,25 € * 125,00 € *

SARS-CoV-2 Nucleocapsid A2 peptide GMSRIGMEV with amino acids 316-324 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell...
Gönderen 106,25 € * 125,00 € *

SARS-CoV-2 Nucleocapsid A2 peptide LLLDRLNQLwith amino acids N223-231 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell...
Gönderen 106,25 € * 125,00 € *
SARS-CoV-2 Spike Protein RBD Recombinant without His-tag is a recombinant protein that is in liquid form buffered in PBS. This protein was produced recombinantly and is HIS-tagged at the C-terminus. This receptor binding domain (RBD) of...
295,75 € *
SARS-CoV-2 Spike Protein RBD Recombinant with C-terminal His-tag is a recombinant protein that is in liquid form buffered in PBS. This protein was produced recombinantly and is HIS-tagged at the C-terminus.This receptor binding domain...
373,12 € *

SARS-CoV-2 Surface A2 peptide with amino acids YLQPRTFLL of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation...
Gönderen 131,25 € * 175,00 € *

SARS-CoV-2 Nucleocapsid A1 peptide with amino acids LTDEMIAQY of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation...
Gönderen 106,25 € * 125,00 € *

SARS-CoV-2 Nucleocapsid KCYGVSPTK with amino acids 138-146 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. Applications for SARS-CoV-2 peptides include, but are not limited to: SARS-CoV-2 T cell stimulation...
Gönderen 106,25 € * 125,00 € *

Serratia nuclease is a non-specific enzyme that cleaves all forms of DNA and RNA very efficiently. It is commonly used on biological material for the quantitative removal of nucleic acids and for viscosity reduction. The nuclease can be...
637,70 € *
TEV-protease is a highly site-specific cysteine protease that is found in the Tobacco Etch Virus (TEV). The Genaxon TEV protease comes with an N-terminal His-tag for simple removal from the cleavage reaction by immobilization on...
Gönderen 174,69 € *

Trypsin from bovine pancreas, Tryptic activity (BAEE): min. 2500 U/mg. Lyophilised. No P. aeruginosa, Salmonella, Staphyloccus aureus detectable. Activity: 1g of Trypsin digests 250g of Casein substrate. Synonym: Peptidylpeptid-Hydrolase...
340,95 € *
Trypsin 1:250 from porcine pancreas (240 - 260 USP U/mg). Contains Chymotrypsin, Elastase and other non proteolytic activities. The native form of Trypsin consists of a single chain polypeptide of 223 amino acid residues, produced by the...
Gönderen 125,12 € *

Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV for stimulation of T-cells. The single peptide (YMDGTMSQV) is used for stimulation of human gp100-specific CD8+ T-cells.
Gönderen 108,75 € * 145,00 € *

The similar peptide Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV (P3175 >) for stimulation of T-cells. The single peptide (YMDGTMSQV) is used for stimulation of human gp100-specific CD8+ T-cells.
Gönderen 108,75 € * 145,00 € *

This peptide pool with 25 peptides covers all mutations in the Spike Glycoprotein derived from the kappa variant B.1.617.1 of SARS-CoV-2 which emerged in India in October 2020. Data from the RKI (Germany): India, Oct. 2020: G142D, E154K,...
262,65 € *

The Variant B.1.617.2 (Delta) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) with 27 peptides covers all mutations in the Spike Glycoprotein derived from the delta variant B.1.617.2 of SARS-CoV-2 which is prevalent in India and carries the...
262,65 € *

This peptide pool of the omicron variant B.1.1.529 BA.5 of SARS-CoV-2 (315 peptides, delivered in two subpools of 158 & 157 peptides) that covers the whole spike glycoprotein with all mutations. Possilbe applications: T-cell assays,...
836,58 € *

This peptide pool with 80 peptides covers all mutations in the Spike Glycoprotein derived from the omicron variant B.1.1.529 of SARS-CoV-2. The peptides of this product are supplied lyophilized as trifluoro acetate salts. This pool...
283,25 € *

This peptide pool of the omicron variant of SARS-CoV-2 (315 peptides, delivered in two subpools of 158 & 157 peptides) that covers the whole spike glycoprotein with all mutations. Possilbe applications: T-cell assays, Immune monitoring,...
836,58 € *
Zymolyase®, produced by a submerged culture of Arthrobacter luteus , has strong lytic activity against living yeast cell walls to produce protoplast or spheroplast of various strains of yeast cells. An essential enzyme for the lytic...
763,95 € *
Zymolyase®, produced by a submerged culture of Arthrobacter luteus , has strong lytic activity against living yeast cell walls to produce protoplast or spheroplast of various strains of yeast cells. An essential enzyme for the lytic...
Gönderen 283,25 € *

α-Defensin 5 (peptide sequence: ATCYCRTGRCATRESLSGVCEISGRLYRLCCR) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a broad spectrum antimicrobial activity against bacteria, viruses, and fungi....
720,00 € *
HIV-1 TAT 47-57 PRAME 301-309 Hyaluronidase MAGE-A4 230 239 Trypsin powder D-Lys3 -GHRP-6 Variant Omicron hGHRP-2 Human Concanavalin A Collagenase HPV 16 E7 49-57 Nona arginine - 3x FLAG Peptide Ova 257-264 rec. Variant Omicron human LL-37 HBV core 18-27 Heparin sodium Growth-hormone- Collagenase HBV envelope alpha-Chymotryp human FSH - gp100 280-288 Collagenase Lysozyme from PADRE - TEV Protease MOG 35-55 rat