Bioactive Proteins

The DYKDDDDK peptide was developed specifically for immunoaffinity chromatography. The peptide allows the competitive elution of proteins (amino terminal, metaminoterminal or carboxy-terminal) FLAG® fusion proteins from anti-FLAG M1 or...

Albumin from hen egg white (ovalbumin) is a phosphorylated glycoprotein that contains 385 amino acid residues and has a molecular weight of 42.7 kDa. Chicken egg white is the protein component with the highest amount of egg white. It is...

Dermcidin-1L (DCD-1) is a 47-amino acid antimicrobial peptide (AMP). It is expressed in eccrine sweat glands, secreted into sweat at a concentration of 1-10µg/mL, and transported to the epidermal surface. Unlike most AMPs, which are...

Dermcidin-1L (DCD-1L) is a 48-amino acid antimicrobial peptide (AMP) with a Leu residue on the C-terminus. It is expressed in eccrine sweat glands, secreted into sweat at a concentration of 1-10µg/mL, and transported to the epidermal...

The DYKDDDDK peptide was specifically designed for immunoaffinity chromatography. It allows elution under mild and non-denaturing conditions. Several antibodies against this peptide have been developed. Usual working concentration is...

LL-37 human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...

LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...

Albumin from chicken egg (Ovalbumin). Crude: min. 80% protein.

Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...

Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...

Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...

Heat treated (equivalent to 10 hours at 60°C). IgG not detectable. Free of mycoplasma and bovine viruses. Free from capryllic acid or other stabilisers that could be cytotoxic to some cell lines. Tested for use in tissue culture.

The manufacturing process uses acetic anhydride and chaotropic agents which destroy nucleases and proteases commonly found in BSA. Genaxxon bioscience acetylated albumin is thus specially recommended for all molecular biology applications.

IgG-free bovine serum albumin. Especially recommended as a blocking and stabilising reagent in all antibody-mediated detection systems. In addition to being IgG-free, this albumin also shows a very low fatty acid content of less than...

Albumin - crystallised is a Fraction V Albumin recrystallised 3 times at temperatures below 0°C. This procedure ensures a very native protein, that is free of carbohydrates, globulines and fatty-acids.

Standard grade, lyophilised Albumin. Bovine serum albumin (BSA) is added as a stabilizing component for proteins/enzymes to several enzyme reaction and storage buffers. The concentration usually ranges from 0.01% (0.1mg/mL) to 3%...