Filtre için sonuç bulunamadı!
| Prod.Nr. | Description | Price € | ||
|---|---|---|---|---|
| S5349.0100 | Human ACE2 recombinant protein.(ECD, processed), Tag-free Recombinant human ACE2 protein (ECD. processed) Tag-free, liquid formulation. We offer high purity. and quality in HEK293 expressed recombinant protein for... | Peptides and Proteins | 701,89 | |
| S5361.0100 | human ACE2 Protein (ECD), Avi/His-Tag, biotinylated Recombinant human ACE2 protein (ECD. processed) contains an Avi/His tag and is biotinylated. We offer high purity. and quality in HEK293 expressed... | Peptides and Proteins | 1058,79 | |
| S5344.0100 | recombinant human ACE2 Protein (ECD), Avi/His-Tag, non-biotinylated reombinant human ACE2 Protein (ECD. processed) contains an Avi/His-Tag, and is ready for invitro biotinylation, We offer high purity. and quality in HEK293... | Peptides and Proteins | 701,89 | |
| S5340.0100 | SARS-CoV-2 Spike S1 Protein (RBD) mit His-Tag SARS-CoV-2 Spike Protein RBD Recombinant with C-terminal His-tag is a recombinant protein that is in liquid form buffered in PBS. This protein was produced... | Peptides and Proteins | 373,12 | |
| C6003.0050 | Coronavirus 2019 Nucleocapsid Mosaic Protein The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused... | Peptides and Proteins | 243,34 | |
| S5341.0050 | SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag... | Peptides and Proteins | 1076,09 | |
| S5342.0050 | SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc... | Peptides and Proteins | 1076,09 | |
| S5343.0050 | SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic - with His-Tag SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and... | Peptides and Proteins | 243,34 | |
| S5346.0050 | SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (800-1000 a.a.)... | Peptides and Proteins | 243,34 | |
| S5345.0050 | SARS-CoV-2 Coronavirus 2019 Spike (300-600) RBD SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain is derived as a recombinant protein from E.Coli. The protein contains the Coronavirus... | Peptides and Proteins | 243,34 | |
| S5347.0050 | SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.)... | Peptides and Proteins | 243,34 | |
| S5348.0100 | SARS-CoV-2 (COVID-19) Nucleocapsidprotein - (1-419), His-Tag Beneath the envelope membrane, the coronavirus SARS-CoV-2 shows an icosahedral nucleocapsid that contains the genetic information in form of positive sensed... | Peptides and Proteins | 513,71 | |
| S5334.0100 | SARS-CoV-2 Spike S1 Protein (RBD) - without Tag SARS-CoV-2 Spike Protein RBD Recombinant without His-tag is a recombinant protein that is in liquid form buffered in PBS. This protein was produced... | Peptides and Proteins | 295,75 | |
| S5333.0100 | SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilized Trimer The engineered recombinant Sars-Co-V-2 Spike S1 protein contains specific amino acid substitutions to stabilize the prefusion conformation (2P). Furthermore,... | Peptides and Proteins | 571,03 | |
| C6018.0020 | rec. Human Interferon-Gamma (rHulFN-g) Recombinant Human IFN-g produced in E.Coli is a single, non-glycosylated, polypeptide chain of 144 amino acids and amolecular mass of 16,879 Dalton.... | Peptides and Proteins | 152,00 | |
| P2299.9501 | human LL-37 [LL-37, 37 aa] LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating... | Peptides and Proteins | 245,14 |
1