Ürünler formu Genaxxon bioscience

Die ganze Bandbreite molekularbiologischer und zellbiologischer Produkte und Dienstleistungen für die erfolgreiche Forschung.

Filtre
Filtreleri kapat
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
 
gönderen alıcı
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
1 Gönderen 3
Filtre için sonuç bulunamadı!
(+)-Aphidicolin, high pure
Aphidicolin inhibits the growth of eukaryotic cells and certain animal viruses by selectively inhibiting the cellular replication of...
  SONDERPREIS:  Gönderen 339,15 € *
[Ala13] Apelin QRPRLSHKGPMPA
Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as...
Listenpreis:  175,00 € *   SONDERPREIS:  Gönderen 140,00 € *
[Ala9] Autocamtide 2 - KKALRRQEAVDAL
Listenpreis:  195,00 € *   SONDERPREIS:  Gönderen 146,25 € *
[alpha]-Bag Cell Peptide (1 - 7) - APRLRFY
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk...
Listenpreis:  125,00 € *   SONDERPREIS:  Gönderen 100,00 € *
[alpha]-Bag Cell Peptide (1 - 9) - APRLRFYSL
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk...
Listenpreis:  125,00 € *   SONDERPREIS:  Gönderen 100,00 € *
[beta]-Amyloid/A4 Protein Precursor (APP) (328...
Amino acid sequence RERMS represents the active domain of amyloid beta/A4 protein precursor that promotes fibroblast growth; H....
  SONDERPREIS:  100,26 € *
[beta]-Bag Cell Peptide - RLRFH
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk...
Listenpreis:  90,00 € *   SONDERPREIS:  Gönderen 85,50 € *
[Des-octanoyl]-Ghrelin, human...
Ghrelin for engl. Growth Hormone Release Inducing is an appetizing hormone found in the gastric mucosa and the pancreas. In addition to...
Listenpreis:  335,00 € *   SONDERPREIS:  Gönderen 318,25 € *
[Des-octanoyl]-Ghrelin, rat...
Ghrelin for engl. Growth Hormone Release Inducing is an appetizing hormone found in the gastric mucosa and the pancreas. In addition to...
Listenpreis:  335,00 € *   SONDERPREIS:  Gönderen 318,25 € *
[Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR
[Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone...
  SONDERPREIS:  238,00 € *
[Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV
[Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV - (HLA-A*02:01) an analog of Melan-A, with Leu substituted for Ala at position 27,...
Listenpreis:  92,70 € *   SONDERPREIS:  Gönderen 74,16 € *
[Phe17] Apelin KFRRQRPRLSHKGPMPF
Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as...
Listenpreis:  238,00 € *   SONDERPREIS:  Gönderen 226,10 € *
0.05% Trypsin in PBS with 0.02% EDTA, w/o Mg2+,...
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.05% Trypsin is produced by dilution of Trypsin in PBS. Due to its...
  SONDERPREIS:  Gönderen 14,95 € *
0.05% Trypsin in PBS with 0.02% EDTA, with...
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.05% Trypsin is produced by dilution of Trypsin in PBS. Due to its...
  SONDERPREIS:  Gönderen 13,53 € *
0.05% Trypsin and 0.1% EDTA in PBS w/o Mg2+,...
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.05% Trypsin is produced by dilution of Trypsin in PBS. Due to its...
  SONDERPREIS:  Gönderen 16,50 € *
0.07 % Ethidium bromide
(2,7-Diamino-10-ethyl-9-phenylphenanthridium bromide) Ethidium bromide is an intercalating agent for nucleic acids. It is widely used...
  SONDERPREIS:  Gönderen 58,93 € *
0.25% Trypsin in HBSS with 1mM EDTA, w/o Mg and...
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.25% Trypsin is produced by dilution of Trypsin in HBSS. Due to its...
  SONDERPREIS:  Gönderen 19,99 € *
0.25% Trypsin in PBS w/o Mg and Ca
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.25% Trypsin is produced by dilution of Trypsin in PBS. Due to its...
  SONDERPREIS:  Gönderen 15,91 € *
0.25% Trypsin in PBS with 0.02% EDTA
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.25% Trypsin is produced by dilution of Trypsin in PBS. Due to its...
  SONDERPREIS:  Gönderen 13,85 € *
0.25% Trypsin in PBS with 0.02% EDTA with...
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.25% Trypsin is produced by dilution of Trypsin in PBS. Due to its...
  SONDERPREIS:  Gönderen 17,53 € *
0.5% Trypsin in PBS with 0.2% EDTA - 10X solution
Trypsin is a mixture of proteases isolated from porcine pancreas. 0.5% Trypsin is produced by dilution of Trypsin in PBS. Due to its...
  SONDERPREIS:  Gönderen 18,61 € *
TE buffer (1X) / Tris-EDTA buffer - pH7.5
Tris-EDTA buffer 1X concentrated, Buffer Grade. pH7.5 +/- 0.2. TE buffer is used in the formulation of buffer solutions in the pH range...
  SONDERPREIS:  Gönderen 38,50 € *
TE buffer (1X) Molecular Biology grade - pH8.0
Tris-EDTA buffer 1X concentrated, molecular biology grade. pH8.0 +/- 0.2. TE buffer is used in the formulation of buffer solutions in...
  SONDERPREIS:  Gönderen 0,53 € *
1-Thio-ß-D-glucose sodium salt dihydrate
Purity: >99% (HPLC). CAS: [10593-29-0] - C6H11NaO5S x 2 H2O
  SONDERPREIS:  Gönderen 120,97 € *
10 x 25 Cryo tubes 5.0 mL (sterile)
Sterile 5mL Cryo tubes specially designed for the storage of biological material (cells, blood, serum, and other biological specimens)...
  SONDERPREIS:  104,96 € *
PBS solution without NaHCO3 (10X)
PBS-solution with Ca and Mg and without NaHCO3. 10-times concentrated. Phosphate-buffered saline (PBS) is a balanced salt solution that...
  SONDERPREIS:  19,98 € *
PBS solution without Mg, Ca, NaHCO3 (10X)
PBS-solution without Ca and Mg and NaHCO3. 10-times concentrated. Phosphate-buffered saline (PBS) is a balanced salt solution that is...
  SONDERPREIS:  17,88 € *
10X Phosphate buffered saline powder (pH7.4) -...
Among biological buffers PBS is one of the most commonly used. The buffer is isotonic and non-toxic to cells and has the ability to...
  SONDERPREIS:  104,00 € *
Custom made 10X PCR Buffer
Custom made 10X PCR Buffer or other buffer solutions. Price is valid for common buffers containing MgCl2, KCl, Tris-HCl, gelatine,...
  SONDERPREIS:  Gönderen 192,95 € *
TBE buffer (10X) ready-to-use solution
This buffer is the most widely used buffer for electrophoresis on agarose or acrylamide gels, it is particularly well suited for...
  SONDERPREIS:  Gönderen 42,32 € *
TBE buffer (10X) ready-to-use solution (MB-Grade)
This buffer is the most widely used buffer for electrophoresis on agarose or acrylamide gels, it is particularly well suited for...
  SONDERPREIS:  Gönderen 45,60 € *
10X Tris buffered saline (pH8.0) - 10 bags
Contents of 1 pouch dissolved in deionized water and made up to 1000mL yields: 0.5M Tris buffered saline, 1.38M NaCl, 0.027M KCl, pH8.0...
  SONDERPREIS:  478,62 € *
10X Tris-Borate-EDTA buffer (pH8.3) - 10 bags
Contents of 1 pouch dissolved in deionized water and made up to 1000mL yields: 0.89M Tris-borate, 0.02M EDTA, pH8.3 at 25°C. In...
  SONDERPREIS:  346,90 € *
10X Tris-EDTA buffer (pH7.4) - 10 bags
10 bags of a 10-fold Tris-EDTA buffer (pH7.4) - ready-to-use Tris/HCl-EDTA powder mixture for 1L ready-to-use buffer solution of pH7.4....
  SONDERPREIS:  189,26 € *
İpucu!
100-place polypropylene storage box with fixed...
100-place polypropylene storage box with fixed lid, and 10x10 dividers for tubes up to 13mm in diameter, eg. 1.5 / 2.0mL...
Listenpreis:  14,96 € *   SONDERPREIS:  4,49 € *
10X PCR Buffer E complete
1.0mL PCR buffer with MgCl2 and with (NH4)2SO4 for efficient DNA amplification. Standard buffer for the Genaxxon Taq DNA Polymerase E,...
  SONDERPREIS:  5,00 € *
10X PCR Buffer E incomplete
1.0mL PCR buffer without MgCl2 but with (NH4)2SO4 for efficient DNA amplification. Standardbuffer for the Genaxxon Taq DNA Polymerase...
  SONDERPREIS:  5,00 € *
10X PCR Buffer S complete
1.0mL PCR buffer with MgCl2 but without (NH4)2SO4 for specific DNA amplification.
  SONDERPREIS:  5,00 € *
10X PCR Buffer S incomplete
1.0mL PCR buffer without MgCl2 and without (NH)4SO4 for specific DNA amplification.
  SONDERPREIS:  5,00 € *
1mL 25mM MgCl2 solution for PCR
1.0mL of a 25mM MgCl2 solution for PCR. Can be used for optimization of PCR reactions. Other volumes or concentrations on request....
  SONDERPREIS:  3,75 € *
2-(4-Aminophenyl)-6-methylbenzothiazole-7-sulfo...
Derivatization (fluorescent) reagent for the HPLC determination of aliphatic thiols.
  SONDERPREIS:  Gönderen 157,22 € *
2-Anthracenylsulfonyl chloride
2-Anthracenylsulfonyl chloride
  SONDERPREIS:  177,58 € *
2.5% Trypsin in PBS (10X)
Trypsin is a mixture of proteases isolated from porcine pancreas. 2.5% Trypsin is produced by dilution of Trypsin in PBS. Due to its...
  SONDERPREIS:  Gönderen 23,01 € *
2',3'- Dideoxyadenosine-5'-O-triphosphate (ddATP)
2',3'-Dideoxyadenosine-5'-O-triphosphate (ddATP) sodium salt of purity >95% HPLC. For other salt forms or a guaranteed higher purity...
  SONDERPREIS:  Gönderen 283,30 € *
2',3'- Dideoxyguanosine-5'-O-triphosphate (ddGTP)
2',3'-Dideoxyguanosine-5'-O-triphosphate (ddGTP) sodium salt of purity >95% HPLC. For other salt forms or a guaranteed higher purity...
  SONDERPREIS:  Gönderen 283,30 € *
2',3'- Dideoxycytidine-5'-O-triphosphate (ddCTP)
2',3'-Dideoxycytidine-5'-O-triphosphate (ddCTP) sodium salt of purity >95% HPLC. For other salt forms or a guaranteed higher purity...
  SONDERPREIS:  Gönderen 283,30 € *
2',3'-Dideoxythymidine-5'-O-triphosphate...
3'-Deoxythymidine-5'-O-triphosphate (2',3'-Dideoxythymidine-5'-O-triphosphate) (dTTP/ddTTP) sodium salt of purity >95% HPLC. For other...
  SONDERPREIS:  Gönderen 294,34 € *
2',7'-Dichlorofluorescein
2',7'-Dichlorofluorescein is a fluorescent dye. Spectral data: Extinction 504nm/Emmission 529nm, in 0.1 M Tris pH 8.0. It is used for...
  SONDERPREIS:  Gönderen 161,52 € *
200 mM L-glutamine (100 X)
200mM L-glutamine solution (100-times). L-Glutamine is an amino acid that is essential for cell culture. L-Glutamine is used in the...
  SONDERPREIS:  Gönderen 17,70 € *
3-(4,6-Difluorotriazinyl)amino-7-methoxycoumari...
3-(4,6-Difluorotriazinyl)amino-7-methoxycoumarin is used as a polarity fluorescence probe.
  SONDERPREIS:  Gönderen 246,97 € *
3,3'5,5'-Tetramethylbenzidine (TMB)
Substrate for horseradish peroxidase detection assays.
  SONDERPREIS:  Gönderen 154,09 € *
3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK
The DYKDDDDK peptide was developed specifically for immunoaffinity chromatography. The peptide allows the competitive elution of...
Listenpreis:  298,70 € *   SONDERPREIS:  Gönderen 238,96 € *
4-{[4-(Dimethylamino)-phenyl]-azo}-benzoic...
4-[[4-(Dimethylamino)-phenyl]azo]-benzoesäure-[3-(iodacetamido)- propyl]-amide is a non-fluorescent FRET quencher. It readily reacts...
  SONDERPREIS:  Gönderen 90,35 € *
BMC, Br-MMC - 5 mg
4-Bromomethyl-7-methoxycoumarin
  SONDERPREIS:  353,28 € *
4-Chloro-1-Naphthol (min. 99.0% HPLC)
4-Chloro-1-naphtol is peroxidase substrate suitable for use in immunoblotting. The endproduct of the enzymatic reaction is an insoluble...
  SONDERPREIS:  Gönderen 96,83 € *
4-Di-2-ASP
4-(4-Diethylaminostyryl)-1-methylpyridinium iodide (4-Di-2-ASP). Some cationic mitochondrial dyes such as 4­Di­1­ASP and 4­Di­2­ASP...
  SONDERPREIS:  131,80 € *
4-Nitrophenyl a-L-fucopyranoside - min. 99%
pNPh-a-L-Fuc, CAS: [22153-71-5] - C12H15NO7
  SONDERPREIS:  Gönderen 208,39 € *
4-Nitrophenyl a-D-manopyranoside - min. 99%
pNPh-a-D-Man, CAS: [10357-27-4] - C12H15NO8
  SONDERPREIS:  Gönderen 291,78 € *
4-Nitrophenyl b-D-xylopyranoside - min. 99%
pNPh-b-D-Xyl - CAS: [2001-96-9] - C11H13NO7
  SONDERPREIS:  Gönderen 175,07 € *
4-Nitrophenyl-2-acetamido-2-deoxy-b-D-glucopyra...
pNPh-b-D-GlcNAc - CAS: [3459-18-5] - C14H18N2O8
  SONDERPREIS:  Gönderen 183,01 € *
4,5-Diaminofluorescein - DAF-2
DAF-2 (4,5-Diaminofluorescein) shows higher photostability than the classical fluorescein derivative DAF. Applications: DAF-2 is highly...
  SONDERPREIS:  Gönderen 268,17 € *
4,5-diaminofluorescein diacetate - DAF-2 DA
4,5-diaminofluorescein diacetate (DAF-2 DA) is a highly sensitive probe for the real time detection of NO in vivo. Cell permeable....
  SONDERPREIS:  Gönderen 292,16 € *
4,5-Diaminofluorescein triazole - DAF-2T
4,5-Diaminofluorescein triazole (DAF-2T) can be used as a reference material for DAF-2 ( S5439 > ). References: (1) M. Feelisch et al;,...
  SONDERPREIS:  Gönderen 263,11 € *
40 x 25 Cryo tubes 1.2mL (sterile)
Sterile 1.2mL Cryo tubes specially designed for the storage of biological material (cells, blood, serum, and other biological...
  SONDERPREIS:  178,26 € *
40 x 25 Cryo tubes 2.0 mL (sterile)
Sterile 2mL Cryo tubes specially designed for the storage of biological material (cells, blood, serum, and other biological specimens)...
  SONDERPREIS:  340,94 € *
5-Aminofluorescein
Description: The uronic acid residues of all known glycosaminoglycuronans react wit 5-aminofluorescein to yield fluorescent...
  SONDERPREIS:  Gönderen 65,17 € *
5-Carboxyfluorescein diacetate N-succinimidyl...
5-CFDA is membrane-permeant and thus can be loaded into cells via incubation. Once inside the cells, 6-CFDA is hydrolyzed by...
  SONDERPREIS:  Gönderen 134,83 € *
5-Carboxyfluorescein succinimidyl ester / 5-FAM-SE
5-Carboxyfluoresceinsuccinimidylester. Amine-reactive fluorescein dye marker for fluorescence labeling, especially for labeling of...
  SONDERPREIS:  Gönderen 112,90 € *
5X TBE buffer (pH8.3) - 10 bags
Contents of 1 pouch dissolved in deionized water and made up to 1000mL yields: 0.445M Tris-borate, 0.01M EDTA, pH8.3 at 25°C. In...
  SONDERPREIS:  245,00 € *
5-FAM DA
5-Carboxyfluorescein diacetate. Carboxyfluorescein diacetate (CFDA), which was originally used to measure intracellular pH but was soon...
  SONDERPREIS:  262,76 € *
5-FAM, single isomer
The single isomer 5-FAM (6-Carboxyfluorescein) is an amine-reactive derivative of Fluorescein > giving stable derivatives upon...
  SONDERPREIS:  Gönderen 58,82 € *
5-JOE single isomer
5-Carboxy-4',5'-dichloro-2',7'-dimethoxyfluorescein and other fluoreszence dyes. Genaxxon bioscience offers a broad range of different...
  SONDERPREIS:  228,56 € *
5-Maleimido-eosin
5-maleimido-eosin is a good photosensitizer and can be used to selectively label thiols. It has a quantum yield of 0.57 for singlet...
  SONDERPREIS:  Gönderen 243,34 € *
5-ROX, single isomer
5-ROX (5-carboxy-X-rhodamine) is a derivative of the amine-reactive carboxy-X-rhodamine (ROX). Compared to the fluoresceine family of...
  SONDERPREIS:  Gönderen 231,48 € *
5-TAMRA (5-carboxytetramethylrhodamine) -...
5-TAMRA is the pure 5-isomer of carboxytetramethylrhodamine (TMR) free acid. The non-activated single isomer carboxytetramethyl...
  SONDERPREIS:  Gönderen 221,37 € *
5-TAMRA-DMTr-phosphoramidite
5-Carboxytetramethylrhodamine DMTr-CE-phosphoramidite (TAMRA-phosphoramidite) for automated 5'- and 3'-labeling of oligonucleotides...
  SONDERPREIS:  484,80 € *
5-TAMRA-SE / 5-Carboxytetramethylrhodamine...
Amine-reactive carboxytetramethylrhodamine is one of the most commonly used red fluorescent dye marker for fluorescence labeling,...
  SONDERPREIS:  Gönderen 338,71 € *
5(6) Carboxy-X-rhodaminsuccinimidylester / 5(6)...
5'/6'-Carboxy-X-rhodaminsuccinimidylester. Amine-reactive rhodamine dye marker for fluorescence labeling, especially for labeling of...
  SONDERPREIS:  Gönderen 145,00 € *
5(6) Carboxyfluorescein succinimidyl ester /...
Amine-reactive fluorescein dye marker for labeling of biomolecules (Abs: 496 nm, Em: 517 nm). This amine-reactive fluorescein...
  SONDERPREIS:  Gönderen 135,00 € *
5(6) TAMRA-SE / 5(6)...
5(6)-Carboxytetramethylrhodamine succinimidyl ester (5(6) TAMRA-SE) is an amine-reactive rhodamine dye marker for fluorescence...
  SONDERPREIS:  Gönderen 177,84 € *
5(6)-Carboxy-2',7'-dichlorofluorescein...
5-(and-6)-Carboxy-2',7'-dichlorofluorescein diacetate, succinimidyl ester is a useful fluorescent tracer that can passively diffuse...
  SONDERPREIS:  Gönderen 266,97 € *
5(6)-Carboxy-2',7'-dichlorofluorescein...
5(6)-Carboxy-2',7'-dichlorofluorescein diacetate, succinimidyl ester (DCFDA NHS ester) is a useful fluorescent tracer that can...
  SONDERPREIS:  Gönderen 365,27 € *
5(6)-CFDA N-succinimidyl ester / 5(6)-FAM DA SE
5(6)-Carboxyfluorescein diacetate N-succinimidyl ester is a useful fluorescent tracer that can passivley diffuse into cells and...
  SONDERPREIS:  Gönderen 175,94 € *
5/6 FAM mixed isomers
The mixed isomers 5/6-FAM (5/6-Carboxyfluorescein) is an amine-reactive derivative of Fluorescein > giving stable derivatives upon...
  SONDERPREIS:  Gönderen 58,82 € *
5/6 FITC / Fluorescein 5(6)-isothiocyanate
Fluorescein 5/6-isothiocyanate mixture of 5 and 6 Fluorescein-isothiocyanate. Reagent for the FITC labeling of proteins,...
  SONDERPREIS:  Gönderen 83,19 € *
5/6-FAM DA
5(6)-Carboxyfluorescein diacetate
  SONDERPREIS:  182,22 € *
5/6-JOE mixed isomer
5/6-Carboxy-4',5'-dichloro-2',7'-dimethoxyfluorescein and other fluoreszence dyes. Genaxxon bioscience offers a broad range of...
  SONDERPREIS:  209,51 € *
5/6-ROX, mixed isomers
5/6-ROX (5/6-carboxy-X-rhodamine) is a derivative of the amine-reactive carboxy-X-rhodamine (ROX). Compared to the fluoresceine family...
  SONDERPREIS:  Gönderen 259,96 € *
5/6-TAMRA (5/6-carboxytetramethylrhodamine) -...
5/6-TAMRA is a mixtures of the 5' and 6' isomers of carboxytetramethylrhodamine (TMR) free acid. The non-activated single isomer...
  SONDERPREIS:  Gönderen 221,37 € *
5% SDS Solution
5% SDS solution as cleansing solution for lenses of optical systems like lathe from EOS GmbH (Electro-Optical Systems). Filtered and...
  SONDERPREIS:  Gönderen 14,07 € *
50X Tris-Acetate-EDTA buffer (pH8.3 - 5 bags)
Contents of 1 pouch dissolved in deionized water and made up to 500mL/1000mL yields: 2.0M Tris acetate buffer, 0.05M EDTA, pH8.3 at...
  SONDERPREIS:  Gönderen 340,20 € *
5X PCR Buffer Red
5X PCR Buffer Red is a ready to use PCR buffer, including all components for standard PCR applications. FEATURES All in one buffer for...
  SONDERPREIS:  14,50 € *
5X qPCR Multiplex MasterMix
5X Multiplex PCR Mastermix for robust PCR with all components for rapid, sensitive and reproducible quantification of DNA. The...
  SONDERPREIS:  Gönderen 25,00 € *
6-(7-Nitrobenzofurazan-4-ylamino)-hexanoic acid...
Fluorescent probe used for investigation of binding sites of fatty acid and sterol carrier proteins, also used for cell membrane staining.
  SONDERPREIS:  Gönderen 186,73 € *
6-Aminofluorescein
Fluoresceinamine Isomer II. Glycosaminoglycuronans react with 6-aminofluorescein to yield fluorescent derivatives.
  SONDERPREIS:  353,57 € *
6-Aminoquinoline N-succinimidyl ester / AQC
6-Aminoquinoline N-succinimidyl ester may be used for covalent labeling of proteins and peptides. Suitable for amino acid or protein...
  SONDERPREIS:  Gönderen 512,01 € *
6-Carboxy-X-rhodamine-N-succinimidyl ester /...
Amine-reactive carboxy-X-rhodamine dye marker for fluorescence labeling, especially for labeling of biomolecules (Abs: 584 nm, Em: 599...
  SONDERPREIS:  Gönderen 262,44 € *
6-Carboxyfluorescein diacetate N-succinimidyl...
6-CFDA is membrane-permeant and thus can be loaded into cells via incubation. Once inside the cells, 6-CFDA is hydrolyzed by...
  SONDERPREIS:  Gönderen 134,83 € *
6-Carboxytetramethylrhodamine-N-succinimidylest...
Amine-reactive carboxytetramethylrhodamine is one of the most commonly used red fluorescent dye marker for fluorescence labeling,...
  SONDERPREIS:  Gönderen 244,42 € *
6-FAM, 6-Carboxyfluorescein - single isomer
The single isomer 6-FAM (6-Carboxyfluorescein) is an amine-reactive derivative of Fluorescein > giving stable derivatives upon...
  SONDERPREIS:  Gönderen 125,00 € *
6-FAM DA
6-Carboxyfluorescein diacetate. Used to differentiate viable cells from apoptotic cells. Live cells that are not apoptotic accumulate...
  SONDERPREIS:  269,54 € *
6-FAM-SE / 6-Carboxyfluorescein succinimidyl ester
6-FAM is a popular green fluorescent cell-permeable dye. Due to the covalent coupling reaction of 6-FAM-SE, 6-FAM can be retained...
  SONDERPREIS:  Gönderen 111,44 € *
6-JOE single isomer
6-JOE (6-Carboxy-4',5'-dichloro-2',7'-dimethoxyfluorescein) and other fluoreszence dyes. Genaxxon bioscience offers a broad range of...
  SONDERPREIS:  228,56 € *
6-ROX, single isomer
6-ROX (6-carboxy-X-rhodamine) is a derivative of the amine-reactive carboxy-X-rhodamine (ROX). Compared to the fluoresceine family of...
  SONDERPREIS:  Gönderen 287,67 € *
6-TAMRA, single isomer
6-TAMRA is the pure 6-isomer of carboxytetramethylrhodamine (TMR) free acid. The non-activated single isomer carboxytetramethyl...
  SONDERPREIS:  Gönderen 297,27 € *
6-TAMRA-DMTr-phosphoramidite
6-Carboxytetramethylrhodamine DMTr-CE-phosphoramidite (TAMRA-phosphoramidite) for automated 5'- and 3'-labeling of oligonucleotides...
  SONDERPREIS:  484,80 € *
6,7-Diethoxy-4-trifluoromethylcoumarin - 50 mg
6,7-Diethoxy-4-trifluoromethylcoumarin
  SONDERPREIS:  618,11 € *
7-Acetoxy-1-methyl-quinolinium iodide
7-Acetoxy-1-methyl-quinolinium iodide
  SONDERPREIS:  726,52 € *
7-Diethylaminocoumarin-3-carboxylic acid / DEAC
DEAC, acid is a useful blue fluorescent building block for labeling amine-containing biomolecules....
  SONDERPREIS:  Gönderen 126,50 € *
7-Methoxy-4-trifluoromethylcoumarin - 100 mg
7-Methoxy-4-trifluoromethylcoumarin
  SONDERPREIS:  376,71 € *
8-cap sealing strips, 300 strips
PCR cap strips (8 caps per strip) for sealing 96-well PCR plates or PCR tube strips. Strips can be removed after PCR and replaced...
  SONDERPREIS:  124,54 € *
8 PCR Tube Strips (0.1 and 0.2mL)
Obtain optimal heat transfer with these 0.1mL low-profile or 0.2mL standard PCR 8-tube strips, with individually attached caps...
  SONDERPREIS:  150,49 € *
9-Anthracenecarbaldehyde
Fluorescent reagents (probe, stain, label) with reactive functional group for chromatography or spectroscopy. Derivatization agent....
  SONDERPREIS:  Gönderen 78,31 € *
9,10-Anthracenediyl-bis(methylene)dimalonic acid
9,10-Anthracenediyl-bis(methylene)dimalonic acid. Reagent for the assay of O2. This substance shows a better characteristic than...
  SONDERPREIS:  Gönderen 108,43 € *
96-well PCR plates, semi skirted, white
Half skirted, rigid 96-well plates. Thin walled for optimal heat transfer producing maximal PCR results. Designed for 0.2mL Thermal...
Listenpreis:  184,10 € *   SONDERPREIS:  110,46 € *
96-well PCR plates, non-skirted, white wells
Non-skirted, 96-well plates. Thin walled for optimal heat transfer producing maximal PCR results. Designed for 0.1mL Thermal Cyclers....
  SONDERPREIS:  Gönderen 175,20 € *
96-well PCR Plates - non-skirted with black coding
Standard 96-well PCR plates without frame can be used in all standard thermal cyclers with a 0.2mL block. Transparent plate with black...
  SONDERPREIS:  Gönderen 151,84 € *
96-well semi-skirted low profile LC480 PCR plates
Standard half skirted, low profile, 96-well PCR plate for Roche LC480. Thin walled for optimal heat transfer producing maximal PCR...
  SONDERPREIS:  Gönderen 183,00 € *
a-D-Galactopyranose-phosphate di-potassium salt...
a-D-Galactose-1-phosphate dipotassium salt dihydrate (synthetic crystalline product). Free carbonate and phosphate are completely...
  SONDERPREIS:  Gönderen 202,60 € *
a-D-Glucopyranose-phosphate di-potassium salt...
a-D-Glucose-1-phosphate dipotassium salt dihydrate, Cori-Ester di-K (synthetic crystalline product). a-D-Glucopyranose-phosphate. Free...
  SONDERPREIS:  Gönderen 61,85 € *
a-D-Mannopyranose-phosphate di-potassium salt...
a-D-Mannose-1-phosphate dipotassium salt dihydrate (synthetic crystalline product). a-D-Mannopyranose-phosphate. Free carbonate and...
  SONDERPREIS:  Gönderen 344,00 € *
Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR
Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone...
  SONDERPREIS:  238,00 € *
Ac-KLVFF-NH2
Ac-KLVFF-NH2 is the N-terminal and C-terminal modified form of the amyloid-beta (16-20) inhibitor peptid KLVFF. The modification leads...
  SONDERPREIS:  Gönderen 158,70 € *
Accutase® Cell Detachment Solution
Accutase® as a cell detachment solution of proteolytic and collagenolytic enzymes useful for the routine detachment of cells from...
  SONDERPREIS:  74,62 € *
Acetyl Coenzyme A (>83% enzymatic)
Acetyl Coenzyme A (Ac CoA) is the end product of glycolysis and takes part in the Ac CoA pathway, which is a metabolic pathway for...
  SONDERPREIS:  Gönderen 140,00 € *
ACTH (1-10), human SYSMEHFRWG
ACTH (1-10), human SYSMEHFRWG is a synthetic peptide according to the first 10 amino acids of the human hormone...
Listenpreis:  90,00 € *   SONDERPREIS:  Gönderen 72,00 € *
ACTH (1-16), human SYSMEHFRWGKPVGKK
ACTH (1-16), human SYSMEHFRWGKPVGKK is a synthetic peptide according to the first 16 amino acids of the human hormone...
  SONDERPREIS:  238,00 € *
ACTH (1-39), human...
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the first 39 amino acids of the human...
Listenpreis:  465,00 € *   SONDERPREIS:  Gönderen 441,75 € *
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the amino acids 18 to 39 of the human hormone...
Listenpreis:  275,00 € *   SONDERPREIS:  Gönderen 261,25 € *
ACTH (4-10), human MEHFRWG
ACTH (4-10), human MEHFRWG is a synthetic peptide according to the amino acids 4 to 10 of the human hormone ACTH/Adrenocorticotropic...
Listenpreis:  90,00 € *   SONDERPREIS:  Gönderen 85,50 € *
Adenosine (>99%)
Synonym: Adenosin, Adenosine, 9-β-D-Ribofuranosyladenine, Adenine riboside, Adenine-9-β-D-ribofuranoside, D-Adenosine
  SONDERPREIS:  Gönderen 49,55 € *
qPCR adhesive plate seals
The Genaxxon qPCR adhesive seals are made of a optically clear adhesive film, with a pressure activated clue. The film is peelable and...
  SONDERPREIS:  Gönderen 135,00 € *
Adhesive Film - Low strength for 96-well plates
This transparent polyester-based film has a low strength adhesive. It is designed as a cost-effective plate sealing option for...
  SONDERPREIS:  46,35 € *
AEBSF Hydrochloride
AEBSF is an irreversible inhibitor of Thrombin and other Serin proteases (Chymotrypsin, Kallikrein, Plasmin, Proteinase K, Trypsin) by...
  SONDERPREIS:  Gönderen 207,55 € *
Empty Spin Columns 20 mL for Affinity...
Empty Spin Columns for standard protein purification procedures, e.g. affinity chromatography with Ni-IDA, Ni-NTA, Co-IDA oder Co-NTA...
  SONDERPREIS:  Gönderen 89,50 € *
Agarose LE - Standard Agarose
Agarose LE is a standard agarose for the separation of DNA in the size range between 100bp and 25kbp. It is suitable for all analytical...
  SONDERPREIS:  Gönderen 85,60 € *
Agarose LE tablets
Agarose LE tablets of 0.5g each for separation of DNA in the size range between 100bp and 25kbp. Agarose LE is suitable for all...
  SONDERPREIS:  Gönderen 148,50 € *
Agarose LM - low melting
Agarose LM is the original low melting agarose. This "molecular biology grade" agarose gives gels with better properties and higher...
  SONDERPREIS:  Gönderen 63,00 € *
Agarose Mega
Agarose Mega resolved DNA and RNA fragments from >100bp up to 50kb. Due to the high gel strength the agarose is ideally suited for...
  SONDERPREIS:  Gönderen 79,77 € *
Agarose Tiny - low melting agarose
Agarose Tiny is a low melting temperature agarose. It is a molecular biology grade agarose with higher sieving properties and higher...
Listenpreis:  85,08 € *   SONDERPREIS:  Gönderen 56,72 € *
Agarose Tiny HT high resolution, normal melting
Our Agarose Tiny HT is a high resolution (+/-2 bp), normal melting agarose for fine resolution of small DNA fragments in the 20 bp to...
  SONDERPREIS:  Gönderen 91,68 € *
Albumin from hen egg white - Ovalbumin
Albumin from hen egg white (ovalbumin) is a phosphorylated glycoprotein that contains 385 amino acid residues and has a molecular...
  SONDERPREIS:  Gönderen 226,29 € *
Alpha MEM Eagle with nucleosides, with...
MEM α (Minimum Essential Medium α) is widely used for mammalian cell culture as well as selection for transfected DHFR-negative cells....
  SONDERPREIS:  67,50 € *
Alpha MEM Eagle with nucleosides, with...
MEM α (Minimum Essential Medium α) is widely used for mammalian cell culture as well as selection for transfected DHFR-negative cells....
  SONDERPREIS:  55,57 € *
Alpha MEM Eagle with Nucleosides, with stable...
Alpha MEM medium, with sodium bicarbonate, with stable glutamine, with ribonucleosides and deoxyribonucleosides, sterile-filtered, for...
  SONDERPREIS:  32,14 € *
Alpha MEM Eagle with Nucleosides, without amino...
Alpha MEM Eagle medium, with Nucleosides, without Amino Acids, with Glucose, without Hepes, with 2.2g/L sodium bicarbonate,...
  SONDERPREIS:  58,48 € *
Alpha MEM Eagle w/o Glutamine, w/o nucleosides
MEM α (Minimum Essential Medium α) is widely used for mammalian cell culture as well as selection for transfected DHFR-negative cells....
  SONDERPREIS:  62,32 € *
Alpha MEM Eagle w/o Nukleosides, w/o Arg, w/o Lys
Alpha MEM Eagle medium, without nucleoside, without Arginine, without Lysine, with Glucose, without Hepes, with Phenol red, with 2.2g/L...
  SONDERPREIS:  64,06 € *
Alpha MEM Eagle with Nucleosides, with...
Alpha MEM medium, with sodium bicarbonate, with L-Glutamine, with Glucose, with ribonucleosides and deoxyribonucleosides,...
  SONDERPREIS:  21,50 € *
Alpha MEM Eagle wo Nucleosides, with...
Alpha MEM medium, with sodium bicarbonate, with L-glutamine, with Glucose, without ribonucleosides and without deoxyribonucleosides,...
  SONDERPREIS:  22,70 € *
alpha-Chymotrypsin (EC 3.4.21.1)
alpha-Chymotrypsin is a serine peptidase that hydrolyzes peptide bonds with aromatic or large hydrophobic side chains (Tyr, Trp, Phe,...
  SONDERPREIS:  Gönderen 69,08 € *
AMCA-H / 7-Amino-4-methyl-3-coumarinylacetic acid
AMCA is one of the brightest amine-reactive blue fluorescent dyes useful for immunofluorescence and fluorescent labeling (Ex/Em:...
  SONDERPREIS:  Gönderen 90,35 € *
Amoxicillin trihydrate
Amoxicillin is an inhibitor of bacterial cell wall synthesis. It inhibits the crosslinking of peptidoglycan by binding and inactivating...
  SONDERPREIS:  Gönderen 87,00 € *
Amphotericin B solution
Amphotericin B is a polyene antifungal that is used in cell culture to suppress fungal and yeast contamination, but does not act on...
  SONDERPREIS:  Gönderen 28,46 € *
Amphotericin B Powder
For tissue culture to prevent growth of yeasts and fungi. Amphotericin B is an antifungal and was isolated from Streptomyces nodosus ....
  SONDERPREIS:  Gönderen 59,85 € *
Amyloid-beta (1-42), rat...
[beta]-Amyloid (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA belongs to the Amyloid-ß-peptides. The characteristic of...
Listenpreis:  724,07 € *   SONDERPREIS:  Gönderen 687,86 € *
Amyloid-beta (16-20) KLVFF inhibitor peptide of...
[beta]-Amyloid (16-20) - KLVFF (peptide sequence: KLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid...
  SONDERPREIS:  100,26 € *
Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ
Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ. Several inhibitors of amyloid-beta aggregation have been published. Many of them are...
  SONDERPREIS:  Gönderen 218,04 € *
Antennapedia (43-58) penetratin
Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of...
Listenpreis:  250,00 € *   SONDERPREIS:  Gönderen 200,00 € *
Antibiotic Antimycotic Solution (100X)
Antibiotic Antimycotic Solution (100X) for prevention of contamination by bacteria, yeasts and moulds. Penicillin G from Penicillium...
  SONDERPREIS:  Gönderen 29,76 € *
Antide Acetate
Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s body to represses FSH and LH releases...
  SONDERPREIS:  Gönderen 186,73 € *
Apramycin sulfate
Apramycin is produced from Streptomyces tenebrarius . It is used to study antibiotic resistance as well as protein synthesis...
  SONDERPREIS:  Gönderen 62,30 € *
İpucu!
AQ97 High Fidelity proofreading Polymerase
AQ97 High Fidelity DNA Polymerase is a proofreading enzyme for robust amplification of DNA targets with low to high GC content and long...
  SONDERPREIS:  Gönderen 99,00 € *
İpucu!
AQ97 High Fidelity MasterMix 2X
AQ97 High Fidelity DNA Polymerase MasterMix 2X is a ready-to-use 2x PCR mix composed of AQ97 High Fidelity DNA Polymerase and an...
  SONDERPREIS:  Gönderen 118,45 € *
ATP (Adenosine 5'-Triphosphate), disodium salt
Adenosine triphosphate (ATP) is the universal and immediately available energy source in cells and an important regulator of energy...
  SONDERPREIS:  Gönderen 50,25 € *
AVG-Cl
(S)-trans-2-Amino-4-(2-aminoethoxy)-3-butenoic acid hydrochloride. AVG (Aminoethoxyvinyl glycine hydrochloride) is a potent inhibitor...
  SONDERPREIS:  Gönderen 343,35 € *
B-Enhancer solution
The better performance of the Genaxxon bioscience 5X B-Enhancer Solution compared to standard enhancers such as form amide, DMSO, TMCA...
  SONDERPREIS:  Gönderen 12,05 € *
Bacitracin powder, min. 55 IU/mg
Bacitracin from Bacillus licheniformis consists of several peptides (A, B, C, D, E, F1-3), bacitracin A, a cyclic dodecapeptide, being...
  SONDERPREIS:  Gönderen 64,20 € *
Basal Medium (Eagle) with EBSS w/o NaHCO3
Basal Medium (Eagle) with EBSS, 1.0g/L glucose, without NaHCO3. Special preparation. Minimal order size: 20 x 500mL. In the fifties of...
  SONDERPREIS:  55,57 € *
Basal Medium (Eagle) with EBSS, w/o phenol red...
Basal Medium (Eagle) with EBSS, 1.0g/L glucose, with 2.2g/L NaHCO3, without Phenol red. Special preparation. Minimal order size: 20 x...
  SONDERPREIS:  58,26 € *
Basal Medium (Eagle) with EBSS, without...
Basal Medium (Eagle) with EBSS without Glutamine, without Glucose, with Phenol red, with 2.2g/L NaHCO3. In the fifties of the last...
  SONDERPREIS:  16,29 € *
BCIP, molecular biology grade
BCIP (5-bromo-4-chloro-3-indolyl phosphate, p-toluidine salt) is a chromogenic substrate for alkaline phosphatase, used in combination...
  SONDERPREIS:  Gönderen 73,97 € *
BES (buffer quality)
BES (N,N-bis(2-hydroxyethyl)-2-aminoethanesulfonic acid) is a useful secondary standard biochemical buffer. Useful pH range for BES is...
  SONDERPREIS:  Gönderen 30,19 € *
Bestatine Hydrochloride
Bestatin is a potent aminopeptidase inhibitor. The compound has multiple physiological functions including the ability to act as an...
  SONDERPREIS:  Gönderen 140,70 € *
Bicine buffer grade
Bicine is recommended for low temperature biochemical work and for the preparation of stable substrate solution for serum guanase...
  SONDERPREIS:  Gönderen 79,70 € *
Bio Lp-1 Legionella DNA Purification Kit
The Bio Lp-1 Legionella DNA Purification Kit was specially developed for our Bio Lp 1 Legionella Detection kit .This Kit provides...
  SONDERPREIS:  256,48 € *
Biotin-11-dUTP Solution, min. 96% (1mM)
Biotin-11-dUTP (Biotin-11-2'-deoxyuridin-5'-triphosphat - Tetralithiumsalt) is a commonly used component for non-radioactive labelling...
  SONDERPREIS:  Gönderen 253,18 € *
Bis-Tris, p.A.
2-[Bis(2-hydroxyethyl)imino]-2-(hydroxymethyl)-1,3-propandiol. Puffersubstanz: Daboo M. and Bates R. (1970) J. Phys. Chem., 74, 702-5....
  SONDERPREIS:  Gönderen 127,24 € *
Bleomycin sulfate, lyophil. pure
Group of glycopeptide antibiotics from Streptomyces verticillus with antineoplastic properties by inhibition of DNA synthesis....
  SONDERPREIS:  Gönderen 162,17 € *
Bluo-Gal /...
5-Bromo-3-indolyl-β-D-galactopyranosid (Bluo-Gal) ist used as a substrat of β-Galactosidase. It is a chromogenic substrate suitable for...
  SONDERPREIS:  Gönderen 126,78 € *
Borate buffered saline tablets (pH8.2) - 100...
1 tablet dissolved in 500mL of deionized water yields: 0.01M Borate buffer, 0.15M Sodium chloride, pH8.2 at 25°C.
  SONDERPREIS:  249,81 € *
Calcium lactate pentahydrate
Calcium lactate pentahydrate - Lactic acid calcium salt Synonym: L-Lactic acid calcium salt; Calcium L-lactate pentahydrate; Calcium...
  SONDERPREIS:  118,97 € *
CAPS >99% pure - buffer grade
3-(Cyclohexylamino)-1-propane sulfonic acid
  SONDERPREIS:  Gönderen 75,50 € *
Carbonate-Bicarbonate buffer tablets (pH9.6)
1 tablet dissolved in 100mL of deionized water yields: 0.05M Sodium Carbonate-bicarbonate buffer, 0.05% Sodium Azide, pH9.6 at 25°C.
  SONDERPREIS:  Gönderen 78,27 € *
Carbonate-Bicarbonate buffer tablets (pH9.6)
1 tablet dissolved in 100mL of deionized water yields: 0.05M Sodium Carbonate-bicarbonate buffer, pH9.6 at 25°C. No time consuming and...
  SONDERPREIS:  Gönderen 101,25 € *
Caesium chloride (99.9 %), Molecular biology grade
Caesium chloride for density centrifµgation. Ideal for the isolation of highly pure RNA without contamination with RNase, or other...
  SONDERPREIS:  Gönderen 115,00 € *
Caesiumchlorid ultrapure (99,999%)
Caesium chloride for density centrifugation. Ideal for the isolation of highly pure RNA without contamination with RNase, or other...
  SONDERPREIS:  945,00 € *
CD20 188-196 (HLA-A*02:01) HLA-A*02:01 SLFLGILSV
Listenpreis:  90,00 € *   SONDERPREIS:  Gönderen 85,50 € *
CD22-4 (371-379) HLA-A*02:01 RLLGKESQL
Listenpreis:  90,00 € *   SONDERPREIS:  Gönderen 85,50 € *
CentriPure 100 columns for protein purification
CentriPure 100 columns are pre-hydrated gel filtration columns for protein purification and desalting. CentriPure 100 Gel Filtration...
  SONDERPREIS:  Gönderen 55,50 € *
CentriPure 2 columns for protein purification
Hydrated gel filtration columns for protein purification and desalting. Processes sample volumes of 150 to 300µL. CentriPure 2 Gel...
  SONDERPREIS:  Gönderen 25,00 € *
CentriPure 5 columns for Purification of Proteins
CentriPure 5 columns are pre-hydrated gel filtration columns for protein purification and desalting. Process sample volume of 500µL....
  SONDERPREIS:  Gönderen 23,79 € *
CentriPure 50 columns for protein purification
CentriPure 50 columns are pre-hydrated gel filtration columns for protein purification and desalting. Processes sample volumes of 5mL....
  SONDERPREIS:  Gönderen 25,00 € *
CentriPure Dye Terminator - 96-well plates
For the rapid and reliable removal of excess dye terminators, primer, dNTPs and other small molecules from completed DNA sequencing...
  SONDERPREIS:  Gönderen 156,34 € *
CentriPure Mini Dye Terminator columns
Die CentriPure CP-0219 columns are specially designed for purification and desalting of oligonucleotides longer than 20 base pairs and...
  SONDERPREIS:  Gönderen 16,77 € *
CentriPure Z25 Mini Spin columns
CentriPure Z25 Mini Spin columns are prehydrated (in water) Mini Columns used for quick and efficient desalting, buffer exchange and/or...
  SONDERPREIS:  Gönderen 25,00 € *
CHAPS for 2D-gel electrophoresis
CHAPS is a nondenaturing zwitterionic detergent for membrane biochemistry, isoelectric focusing and two-dimensional electrophoresis....
  SONDERPREIS:  Gönderen 132,42 € *
CHAPS buffer grade
CHAPS is a nondenaturing zwitterionic detergent for membrane biochemistry, isoelectric focusing and two-dimensional electrophoresis....
  SONDERPREIS:  Gönderen 89,55 € *
CHAPSO - min. 99.0% (HPLC)
3-[(3-Cholamidopropyl)-dimethylammonio]-2-hydroxy-1-propane sulfonate
  SONDERPREIS:  Gönderen 100,43 € *
İpucu!
CHES, min. 99.0%
CHES shows a pKa (25°C) of 9,55 which makes CHES useful as a buffering component in the pH range between 8.6 to 12.0. CHES interferes...
Listenpreis:  91,27 € *   SONDERPREIS:  Gönderen 45,64 € *
Chymotrypsinogen A - Chymotrypsin precursor
Chymotrypsinogen is the practically inactive "precursor" (proenzyme, or zymogen) of chymotrypsin. In order to be activated,...
  SONDERPREIS:  395,45 € *
Citric acid trisodium salt dihydrate, p.A. min....
Citric acid trisodium salt (tri-sodium citrate, sodium citrate) is used as a buffering substance for molecular biology buffers.
  SONDERPREIS:  Gönderen 50,55 € *
CMRL-1066 with L-Glutamine
CMRL-1066 with L-Glutamine, without Phenol red, with 2.2g/L NaHCO3, sterile filtered. CMRL is a nucleoside and vitamin-rich medium. In...
  SONDERPREIS:  62,32 € *
CMRL-1066 without L-Glutamine, without Phenol red
CMRL-1066 without L-Glutamine, without Phenol red, with 2.2g/L NaHCO3, sterile filtered. CMRL is a nucleoside and vitamin-rich medium....
  SONDERPREIS:  34,26 € *
CMV IE-1 (199-207) - ELRRKMMYM
CMV IE-1 ELRRKMMYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human...
Listenpreis:  90,00 € *   SONDERPREIS:  Gönderen 72,00 € *
CMV IE-1 (316-324) (I1) HLA-A*02:01 ILEETSVML
Antigen peptide IE (316-324) (I1) HLA-A*02:01 (ILEETSVML) for stimulation of antigen-specific T cells in T cell assay such as ELISPOT,...
Listenpreis:  95,00 € *   SONDERPREIS:  Gönderen 76,00 € *
CMV IE-1 (316-324) HLA-A*0201 VLEETSVML
CMV IE-1 (316-324) HLA-A * 0201 VLEETSVML for stimulation of T cells. The peptide was synthesized as presented by MHC class I...
Listenpreis:  145,00 € *   SONDERPREIS:  Gönderen 116,00 € *
CMV IE-1 (99-107) RIKEHMLKK
IE-1 stands for immediate-early protein 1. CMV stands for human cytomgealovirus, HCMV for human cytomegalovirus or HPV human herpesvirus.
Listenpreis:  95,00 € *   SONDERPREIS:  Gönderen 76,00 € *
CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY
CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von...
Listenpreis:  90,00 € *   SONDERPREIS:  Gönderen 85,50 € *
CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK
CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules....
Listenpreis:  90,00 € *   SONDERPREIS:  Gönderen 72,00 € *
CMV pp65 (417-426) HLA-B*07:02 TPRVTGGGAM
CMV pp65 (417-426) HLA-B * 07: 02 TPRVTGGGAM for stimulation of T cells. The peptide was synthesized as presented by MHC class I...
Listenpreis:  145,00 € *   SONDERPREIS:  Gönderen 108,75 € *
CMV pp65 (417-426), amid HLA-B*07:02...
CMV pp65 (417-426) HLA-B * 07: 02 TPRVTGGGAM for stimulation of T cells. The peptide was synthesized as presented by MHC class I...
Listenpreis:  165,00 € *   SONDERPREIS:  Gönderen 140,25 € *
CMV pp65 (495-503) HLA-A*02:01 NLVPMVATV
Single peptide (NLVPMVATV) for stimulation of human CMV specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC...
Listenpreis:  145,00 € *   SONDERPREIS:  Gönderen 116,00 € *
Co-NTA-Agarose for His-tagged proteins
NTA-Agarose consists of the tetradentate chelating agent, nitrilotriacetic acid (NTA), covalently coupled agarose beads, and is loaded...
  SONDERPREIS:  Gönderen 215,99 € *
Co-NTA MagBeads for His-tagged protein...
Protein purification based on magnetic beads has become popular because they are useful to extract proteins from diluted solutions,...
  SONDERPREIS:  Gönderen 108,01 € *
Coenzyme A trilithium salt (>93%)
Coenzyme A (CoA, CoASH, HSCoA) is a coenzyme that facilitates enzymatic acyl-group transfer reactions and supports the synthesis and...
  SONDERPREIS:  Gönderen 146,64 € *
Colchicine
Colchicine is an antimitotic agent that disrupts microtubules by binding to tubulin and preventing its polymerization. Stimulates the...
  SONDERPREIS:  Gönderen 86,33 € *
Collagenase Type I (EC 3.4.24.3) >100 units/mg
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities....
Listenpreis:  114,20 € *   SONDERPREIS:  Gönderen 79,94 € *
Collagenase Type II (EC 3.4.24.3) >180 units/mg
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Type II...
Listenpreis:  114,20 € *   SONDERPREIS:  Gönderen 79,94 € *
Collagenase Type III (EC 3.4.24.3)
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities....
  SONDERPREIS:  1.364,75 € *
Collagenase Type IV (EC 3.4.24.3) >900 units/mg
Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities....
Listenpreis:  125,00 € *   SONDERPREIS:  Gönderen 100,00 € *
Collagenase-Chromophore-Substrate Component A
Collagenase-Chromophore-Substrate Component A also named 4-Phenylazobenzyloxycarbonyl-Pro-Leu-Gly-Pro-D-Arg-OH x 2H2O.
  SONDERPREIS:  407,69 € *
Concanavalin A lectin
Concanavalin A is a member of a group of proteins called lectins which are proteins that react with specific sugar residues. It has...
  SONDERPREIS:  Gönderen 87,75 € *
Coral Red Buffer Dye solution (10X)
Coral Red Buffer is a 10-time dye solution as supplement for PCR buffers. This additive contains Glycerol, EDTA, a red and a yellow...
  SONDERPREIS:  Gönderen 23,84 € *
Coronavirus 2019 Nucleocapsid Mosaic Protein
The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full...
  SONDERPREIS:  Gönderen 243,34 € *
Coumarin 120 / AMC
7-Amino-4-methylcoumarin. Fluorophore for preparing fluorogenic substrates for cystine aminopeptidase (and other hydrolases). Used as...
  SONDERPREIS:  630,39 € *
Coumarin 6 - 2 g
3-(2-Benzothiazolyl)-7-(diethylamino)coumarin
  SONDERPREIS:  Gönderen 114,44 € *
Cryo tubes 4.0 mL (sterile) - 5 x 100 tubes
Cryo tubes specially designed for the storage of biological material down to -196°C (liquid nitrogen) to ensure a tight, leakproof seal...
  SONDERPREIS:  245,98 € *
Adenosine-3',5'-cyclic monophosphate sodium...
Adenosine-3′,5′-cyclic monophosphate (cAMP) is an activator of cyclic-AMP-dependent protein kinase A (PKA). The cAMP/PKA signaling...
  SONDERPREIS:  Gönderen 197,99 € *
CyLoP-1 peptide (CRWRWKCCKK)
CPPs, such as CyloP-1, are generally taken up by endocytic pathways, with vesicular encapsulation being a limiting factor in...
Listenpreis:  160,00 € *   SONDERPREIS:  Gönderen 144,00 € *
Cytosine
Cytosin, 4-Amino-2-hydroxypyrimidine. Cytosine is one of the four main bases found in DNA and RNA, along with adenine, guanine, and...
  SONDERPREIS:  Gönderen 86,48 € *
YENİ
D.(+)-Galacturonic acid monohydrate (>98% by...
Galacturonic acid (GalA) is the primary building block of mainly pectin but also other biopolymers found in plants. The polymeric GalA...
  SONDERPREIS:  Gönderen 175,00 € *
D-Galactosamine x HCl
Galactosamine is a hexosamine derived from galactose with the molecular formula C6H13NO5. This amino sugar is a constituent of some...
  SONDERPREIS:  Gönderen 123,50 € *
D-Glucosamine x HCl, min. 99% (HPLC)
CAS: [66-84-2] - C6H13NO5 x HCl
  SONDERPREIS:  Gönderen 76,99 € *
D-Luciferin potassium salt
D-Luciferin also named Firefly Luciferin is the most popular and versatile bioluminescent substrate. Firefly luciferase produces light...
  SONDERPREIS:  Gönderen 87,55 € *
D-Mannitol, min. 98% (HPLC)
D-Mannitol. Purity >99.3%, CAS: [69-65-8] - C6H14O6
  SONDERPREIS:  Gönderen 54,98 € *
D-Mannose, min. 99% (HPLC)
CAS: [3458-28-4] - C6H12O6
  SONDERPREIS:  Gönderen 39,60 € *
D-Raffinose pentahydrate (min. 98% HPLC)
D-Raffinose also known as O-α-D-Galactopyranosyl-(1→6)-α-D-glucopyranosyl β-D-fructofuranoside; Melitose; Melitriose; Melitose...
  SONDERPREIS:  Gönderen 68,20 € *
D-TAT (47-57) ygrkkrrqrrr-NH2
Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of...
  SONDERPREIS:  Gönderen 287,50 € *
D-Xylulose (min. 99%)
Synonyms: D-threo-pent-2-ulose. Xylulose a ketopentose, is a monosaccharide containing five carbon atoms, and including a ketone...
  SONDERPREIS:  Gönderen 364,06 € *
D(+)-Fucose (6-Deoxy-D-galactose), min. 99%
D-Fucose (6-Deoxy-D-galactose) may be used for different purposes. 1. In studies of fucoidan polysaccharide containing glycans. 2....
  SONDERPREIS:  Gönderen 81,11 € *
D(+)-Galactose from beech (min. 98.0% HPLC)
Highly pure D(+)-Galactose derived from beech. Guaranteed free of any animal contaminants!
  SONDERPREIS:  Gönderen 50,75 € *
D(+)-Galactose from lactose (min. 98.0% HPLC)
Galactose is a monosaccharide. When combined with glucose (monosaccharide), through a condensation reaction, the result is the...
  SONDERPREIS:  Gönderen 39,60 € *
D(+)-Maltose monohydrate Biochemica (min. 95%...
Maltobiose, 4-O-a-D-Glucopyranosyl-D-glucose, CAS: [6363-53-7] - C12H22O11H2O
  SONDERPREIS:  Gönderen 44,00 € *
D(+)-Trehalose dihydrate, min. 98% (HPLC)
Trehalose , also known as mycose or strong>tremalose, is a natural alpha-linked disaccharide formed by an alpha,alpha(1,1) glucoside...
  SONDERPREIS:  Gönderen 104,74 € *
D(+)Glucose 20% - 5 bags
Content of 1 pouch dissolved in deionized water and made up to 1000mL yields: 20% D(+)Glucose
  SONDERPREIS:  165,74 € *
DABCYL
4-[[4-(Dimethylamino)-phenyl] azo]-benzoic acid
  SONDERPREIS:  Gönderen 113,56 € *
DAF-4
  SONDERPREIS:  766,86 € *
DAF-4T
  SONDERPREIS:  879,89 € *
DAF-FM / 3-Amino-4-(N-methylamino)-2',...
3-Amino-4-(N-methylamino)-2',7'-difluorofluorescein diacetate. DAF-FM DA is an important reagent for quantification of low...
  SONDERPREIS:  Gönderen 399,73 € *
DAF-FM DA /...
3-Amino-4-(N-methylamino)-2',7'-difluorofluorescein diacetate. DAF-FM DA is an important reagent for quantification of low...
  SONDERPREIS:  Gönderen 399,73 € *
DAPI - 4',6-Diamidino-2-phenylindole...
4',6-Diamino-2-phenylindole hydrochloride is a fluorescent dye binding selectively to the minor groove of double strand DNA...
  SONDERPREIS:  Gönderen 91,75 € *
DAR 1T
  SONDERPREIS:  734,59 € *
DAR-1 / 4,5-Diamino-rhodamine B
4,5-Diamino-N,N,N',N'-tetraethyl-rhodamine. Sensitive NO probe, LOD of 10 nM, shows higher photostability than the classical...
  SONDERPREIS:  Gönderen 156,85 € *
DAR-2
DAR-2 (5,6-Diamino-N,N,N',N'-tetraethyl-rhodamine) is a sensitive NO probe, LOD of 10nM, shows higher photostability than the classical...
  SONDERPREIS:  169,53 € *
DAR-2T
  SONDERPREIS:  783,02 € *
DAR-4MT
  SONDERPREIS:  928,31 € *
dATP (2'-deoxyadenosine 5'-triphosphate)...
Highly pure, HPLC purified 2'-Deoxyadenosine 5'-triphosphate (dATP >99%) delivered as 100 mM soution for use in qPCR, standard PCR,...
  SONDERPREIS:  Gönderen 45,00 € *
DCCS - 100 mg
7-Diethylaminocoumarin-3-carboxylic acid N-succinimidyl ester
  SONDERPREIS:  352,33 € *
dCTP solution - 100mM
100mM solution of 2'-Deoxycytidine 5'-triphosphate (dCTP) of purity >99%. Product has been tested for PCR products of length up to...
  SONDERPREIS:  Gönderen 45,00 € *
Demecolcine - 25 mg
Colcemide (trademark of Ciba-Geigy Corporation). Demecolcine, N-Deacetyl-N-methylcolchicine. Used for cell synchronization by arresting...
  SONDERPREIS:  605,43 € *
DF Taq Polymerase E (DNA free)
Especially suitable for use in microbiology, the DNA freeTaq Polymerase DF Taq E for high yields is virtually free of foreign DNA. The...
  SONDERPREIS:  Gönderen 74,35 € *
DF Taq Polymerase S (DNA-free)
Especially suitable for use in microbiology, the DNA free Taq Polymerase DF Taq S for high specificity is virtually free of foreign...
  SONDERPREIS:  Gönderen 74,35 € *
dGTP (2'-Deoxyguanosine 5'-triphosphate)...
Highly pure, HPLC purified 2'-Deoxyguanosine 5'-triphosphate (dGTP / >99%) delivered as 100 mM soution for use in qPCR, standard PCR,...
  SONDERPREIS:  Gönderen 45,00 € *
DIB-Cl /...
4-(4,5diphenyl-1H-imidazol-2-yl)-benzoyl chloride (DIB-Cl) as reagent for amines was used successfully to derivatize and fluorescence...
  SONDERPREIS:  Gönderen 251,84 € *
Diethylene glycol
Diethylene glycol is a colourless liquid which is mostly used in manufacturing other chemicals. It is denser than water. It can be...
  SONDERPREIS:  37,81 € *
DEPC
Diethylpyrocarbonate modifies histidyl residues in proteins and leads to their inactivation. In molecular biology it is mainly used as...
  SONDERPREIS:  Gönderen 82,09 € *
DIHFP - 25 mg
Diphenyliodonium hexafluorophosphate
  SONDERPREIS:  241,40 € *
Dihydroethidium
Synonym: 2,7-Diamino-10-ethyl-9-phenyl-9,10-dihydrophenanthridine; 3,8-Diamino-5,6-dihydro-5-ethyl-6-phenylphenanthridine; Hydroethidine
  SONDERPREIS:  314,63 € *
Dihydrorhodamine 123 - DHR
Dihydrorhodamine 123 is a cell-permeable non-fluorescent substance used as an indicator for reactive oxygen species (ROS) substances....
  SONDERPREIS:  Gönderen 91,93 € *
DL-Dithiothreitol (DTT) - BioChemica
Dithiothreitol (DTT) is an isomer (epimer) of dithioerythritol (DTE). In principle, DTT can be exchanged for DTE or DTE for DTT, of...
  SONDERPREIS:  Gönderen 50,06 € *
DL-Dithiothreitol (DTT) - Molecular biology grade
Dithiothreitol (DTT) is an isomer (epimer) of dithioerythritol (DTE). In principle, DTT can be exchanged for DTE or DTE for DTT, of...
  SONDERPREIS:  Gönderen 62,85 € *
DMEM for SILAC(TM) w/o Glutamine, w/o...
Dulbecco's Modified Eagle Medium (DMEM), with 4.5g/L glucose, no glutamine, no lysine, no arginine is a basal cell culture medium for...
  SONDERPREIS:  65,00 € *
DMEM with 1g/L L-Glucose, w/o glutamine,...
Dulbecco's Modified Eagle Medium (DMEM), 1.0g/L glucose, no L-glutamine, no L-isoleucine. Special preparation. Minimum order size: 20 x...
  SONDERPREIS:  65,00 € *
DMEM with L-glutamine, w/o Glucose, w/o Serine...
Dulbecco's Modified Eagle Medium (DMEM), with L-glutamine, no glucose, no serine, no Sodium pyruvate. Special preparation. Minimum...
  SONDERPREIS:  65,00 € *
DMEM with L-Glutamin, with 1.0g/L Glucose
DMEM with L-Glutamine, with 1.0g/L glucose, with Sodium pyruvate, without Phenol red, with 3,7g/L NaHCO3. DMEM (Dulbecco's Modified...
  SONDERPREIS:  15,75 € *
DMEM with L-Glutamin, with 4,5g/L Glucose
DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal medium for supporting the growth of many different mammalian cells....
  SONDERPREIS:  17,20 € *
DMEM with L-Glutamine, with 4.5g/L Glucose, w/o...
DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal medium for supporting the growth of many different mammalian cells....
  SONDERPREIS:  14,76 € *
DMEM with L-glutamine, with 4.5g/L Glucose, w/o...
Dulbecco's Modified Eagle Medium (DMEM), 4.5g/L glucose, no serine, no Sodium pyruvate. Special preparation. Minimum order size: 20 x...
  SONDERPREIS:  65,00 € *
DMEM with stable Glutamin, with 4.5g/L Glucose
DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal medium for supporting the growth of many different mammalian cells....
  SONDERPREIS:  15,34 € *
DMEM with stable Glutamine, with 1.0g/L Glucose
DMEM (low glucose) with stable glutamine (L-alanyl-L-glutamine), with 1.0g/L glucose. Equivalent/alternative to: Biochrom Cat.-no. FG...
  SONDERPREIS:  15,75 € *
DMEM w/o Glutamine, w/o Arginine, w/o Lysin,...
Dulbecco's Modified Eagle Medium (DMEM), 4.5g/L glucose, no glutamine, no lysine, no arginine, no methionine is a basal cell culture...
  SONDERPREIS:  65,00 € *
DMEM w/o arginine, w/o glutamine, with Sodium...
Dulbecco's Modified Eagle Medium (DMEM), 4.5g/L glucose, no L-glutamine, no L-arginine, with Sodium pyruvate. Special preparation....
  SONDERPREIS:  65,00 € *
DMEM w/o Glutamin, with 4.5g/L Glucose, w/o...
DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal medium for supporting the growth of many different mammalian cells....
  SONDERPREIS:  18,60 € *
DMEM w/o glutamine, with 4.5g/L glucose, w/o NEAAs
Dulbecco's Modified Eagle Medium (DMEM), 4.5g/L glucose, w/o L-Glutamine, w/o non-essentail amino acids, w/o Sodium pyruvate, w/o...
  SONDERPREIS:  65,00 € *
DMEM w/o glutamine, w/o amino acids, with 1g/L...
Dulbecco's Modified Eagle Medium (DMEM), 1.0g/L glucose, no L-glutamine, no amino acids. Special preparation. Minimal order size:...
  SONDERPREIS:  65,00 € *
DMEM w/o glutamine, w/o amino acids, with...
Dulbecco's Modified Eagle Medium (DMEM), 4.5g/L glucose, no L-glutamine, no amino acids. Special preparation. Minimal order size: 20 x...
  SONDERPREIS:  65,00 € *
DMEM w/o glutamine, w/o Arginine, w/o Lysine,...
Dulbecco's Modified Eagle Medium (DMEM), no glucose, no glutamine, no lysine, no arginine is a basal cell culture medium for use during...
  SONDERPREIS:  65,00 € *
DMEM w/o glutamine, w/o Cystine, w/o...
Dulbecco's Modified Eagle Medium (DMEM), w/o glucose, no L-glutamine, no L-cysteine, no L-methionine, no Sodium pyruvate. Special...
  SONDERPREIS:  72,00 € *
DMEM w/o L-Cysteine, w/o L-Methionine, w/o...
Dulbecco's Modified Eagle Medium (DMEM), 4.5g/L glucose, no L-cysteine, no L-methionine, no L-glutamine. Special preparation. Minimum...
  SONDERPREIS:  65,00 € *
DMEM without L-Glutamin, with 1.0g/L Glucose
DMEM without L-Glutamine, with 1.0g/L glucose. Equivalent/alternative to: Biochrom Cat.-no. F 0415, or to Bio&Sell No. BS.F0415. DMEM...
  SONDERPREIS:  15,75 € *
DMEM without L-Glutamin, with 4,5g/L Glucose
DMEM (Dulbecco's Modified Eagle Medium) is a widely used basal medium for supporting the growth of many different mammalian cells....
  SONDERPREIS:  13,39 € *
DMEM w/o L-Glutamine, w/o Ca, with 1g/L...
Dulbecco's Modified Eagle Medium (DMEM), 1.0g/L glucose, no L-glutamine, no Calcium. Special preparation. Minimum order size: 20 x...
  SONDERPREIS:  65,00 € *
DMEM without L-Glutamin, with 1.0g/L Glucose
DMEM (low glucose) with stable glutamine (L-alanyl-L-glutamine), with 1.0g/L glucose. Equivalent/alternative to: Biochrom Cat.-no. F...
  SONDERPREIS:  15,57 € *
DMEM:F12, 1:1 Mix w/o phenol red
DMEM:F12, 1:1 Mix with L-Glutamine, without Phenol red, with 1.2g/L NaHCO3. DMEM/F-12 is a 1:1 mixture of Dulbecco's Modified Eagle...
  SONDERPREIS:  27,50 € *
DMEM:F12, 1:1 Mix with L-Glutamine, with 15mM...
DMEM:F12, 1:1 Mix with L-Glutamine, with 15mM HEPES, with Phenol red, with 1.2g/L NaHCO3. DMEM/F-12 is a 1:1 mixture of Dulbecco's...
  SONDERPREIS:  14,52 € *
DMEM:F12, 1:1 Mix with L-Glutamine, w/o Glucose
DMEM:F12, 1:1 Mix with L-Glutamine, with 1.2g/L NaHCO3, without Glucose, without Phenol red. Special preparation. Minium order size: 20...
  SONDERPREIS:  65,00 € *
DMEM:F12, 1:1 Mix with stable glutamine - 500 mL
DMEM:F12, 1:1 Mix with stable glutamine, with 1.2g/L NaHCO3. DMEM/F-12 is a 1:1 mixture of Dulbecco's Modified Eagle Medium and Ham's...
  SONDERPREIS:  15,97 € *
DMEM/F12, 1:1 Mix with stable Glutamine, with...
DMEM:F12, 1:1 Mix with stable Glutamine, with 1.2g/L NaHCO3, with Glucose, without Phenol red. DMEM/F-12 is a 1:1 mixture of Dulbecco's...
  SONDERPREIS:  13,13 € *
DMEM:F12, 1:1 Mix with stable glutamine, with...
DMEM:F12, 1:1 Mix with stable glutamine, with 15mM Hepes buffer, with 4.7g/L NaHCO3. Special preparation. Minium order size: 20 x...
  SONDERPREIS:  65,00 € *
DMEM:F12, 1:1 Mix w/o all amino acids, with...
Microbiological Medium for the cultivation of Borrelia burgdorferi. We will supply each formulation, different from the given. Special...
  SONDERPREIS:  65,00 € *
DMEM:F12, 1:1 Mix w/o L-Cystine, w/o L-Cysteine...
DMEM:F12, 1:1 Mix without L-Cystine, without L-Cysteine hydrochloride, without L-Methionine, with Glucose with 4.7g/L NaHCO3, sterile...
  SONDERPREIS:  65,00 € *
DMEM:F12, 1:1 Mix with stable glutamine, with...
DMEM:F12, 1:1 mixture without L-glutamine, with 15mM Hepes buffer and 1.2/L NaHCO3. Can be supplemented by adding 7% NaHCO3 (> C4213)...
  SONDERPREIS:  13,34 € *
DMEM:F12, 1:1 Mix w/o L-Glutamine, w/o glucose...
DMEM:F12, 1:1 Mix without Glucose, without L-Glutamine, with 1.2g/L NaHCO3. Special preparation. Minium order size: 20 x 500mL....
  SONDERPREIS:  65,00 € *
DMEM:F12, 1:1 Mix w/o L-Methiionine, with HEPES
DMEM:F12, 1:1 Mix without L-Methionine, with HEPES, with 1.2g/L NaHCO3, sterile filtered. Special preparation. Minium order size: 20 x...
  SONDERPREIS:  65,00 € *
DMSO, Molecular biology grade
DMSO is an aprotic polar solvent that is used in chemical reactions as well as in PCR or as anti-freeze protection in the deep-freeze...
  SONDERPREIS:  Gönderen 39,91 € *
DMSO, Cell culture grade
DMSO is an aprotic polar solvent used in chemical reactions, in PCR and as a cryoprotectant agent for the preservation of cells,...
  SONDERPREIS:  Gönderen 39,91 € *
DMSO, p. A., min. 90%
Dimethyl sulfoxide. Highly active solvent and pharmaceutical vehicle, for freezing cells. For gradient centrifugation. Determination of...
  SONDERPREIS:  Gönderen 36,52 € *
DNA Loading buffer II with Orange G
DNA 6X Loading buffer is a special loading buffer for DNA application on gels that enables viusalization of DNA bands smaller than 100...
  SONDERPREIS:  Gönderen 22,05 € *
DNA Loading buffer I
Gel Loading Dye I 6X is a loading buffer for DNA application on gels. Buffer contains Glycerol, EDTA, Bromophenol Blue and Xylene...
  SONDERPREIS:  Gönderen 22,05 € *
YENİ
DNA Loading buffer I Fluoro (6x)
Loading buffer I Fluoro is a fluorescent reagent that produces instant visualization of DNA bands upon blue light or UV illumination of...
  SONDERPREIS:  25,00 € *
DNA Purification Columns
Mini DNA purification columns (40µL - 100µL elution volume) for DNA purification kits of different suppliers, e.g. Qiagen, Zymo,...
  SONDERPREIS:  37,85 € *
Nucleic acid Extraction Solution
The non-toxic DNA Q-Extraction Solution is optimized for easy extraction of PCR-ready DNA. DNA is easily extracted from various...
  SONDERPREIS:  Gönderen 59,48 € *
DNase I (EC 3.1.21.1)
DNase I is an endonuclease isolated from bovine pancreas that digests double- and single-stranded DNA into oligo- and mono-nucleotides....
  SONDERPREIS:  Gönderen 34,94 € *
dNTP Mix (Na salt) - 10mM
Deoxynucleotide (dNTP) Solution Mix as an equimolar solution of ultrapure, HPLC purified (>99%) dATP, dCTP, dGTP and dTTP for qPCR,...
Listenpreis:  20,00 € *   SONDERPREIS:  Gönderen 14,00 € *
dNTP-Set (Na salt) - 100mM
Highly pure, HPLC purified (>99%) dNTPs packaged as 4 separate 100mM solutions of dATP, dCTP, dGTP and dTTP for qPCR, RT-PCR, standard...
  SONDERPREIS:  Gönderen 50,00 € *
Doxycycline Hyclat
Doxycycline belongs to the generation of the newer tetracycline derivatives and is active against grampositive and gramnegative germs....
  SONDERPREIS:  Gönderen 36,99 € *
DTE, molecular biology grade
Dithioerythritol (DTE) ist ein Isomer des Dithiothreitol (DTT). Prinzipiell ist DTE gegen DTT austauschbar bzw. DTT gegen DTE. DTE hat...
  SONDERPREIS:  Gönderen 78,38 € *
dTTP (2'-Deoxythymidine 5'-triphosphate)...
Highly pure, HPLC purified 2'-Deoxythymidine 5'-triphosphate (dTTP / >99%) delivered as 100 mM soution for use in qPCR, standard PCR,...
  SONDERPREIS:  Gönderen 45,00 € *
Dulbecco's PBS solution with Ca and Mg, without...
PBS-solution with Ca and Mg, without NaHCO3. Phosphate-buffered saline (PBS) is a balanced salt solution that is used for a variety of...
  SONDERPREIS:  14,54 € *
1 Gönderen 3
DNA Loading hGHRP-2 Human Penicillin-Stre D-Lys3 -GHRP-6 Sodium 5X qPCR Collagenase GenLadder 100 Ova 257-264 Collagenase SafeGel red GelRed in water DMSO Cell Proteinase K GreenMasterMix SNP Pol DNA rec. Trypsin powder GenLadder 1kb human FSH - Ribonuclease A Lysozyme from Agarose LE - GenLadder 100 dNTP Mix Na Collagenase Storage Box for Red MasterMix L-Fucose One-Step