rec. Human Interleukin-10 (rHuIL-10)

rec. Human Interleukin-10 (rHuIL-10)


Sipariş numarası: C6077.0002

Shipping: shipped at RT, stored at -20°C

Bugün gönderilmek için hazır,
Teslim süresi yaklaşık olarak 1-3 iş günü

194,93 € *

Weight:

Please select the favoured pack size.

IL10 is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This... daha fazla
Ürün bilgileri "rec. Human Interleukin-10 (rHuIL-10)"

IL10 is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Interleukin-10 is fully biologically active when compared to standard. The ED50 as determined by the dose-dependent co-stimulation (with murine IL-4) of MC/9 cells was found to be less than 2.0ng/mL, corresponding to a specific activity of 5.0×105 IU/mg. Amino acid composition: MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN.

İlgili bağlantılar "rec. Human Interleukin-10 (rHuIL-10)"
Purity: >97.0% (by RP-HPLC, IEX-HPLC, SDS-PAGE). Less than 1% dimers and aggregates. Sterile... daha fazla
 

Technische Daten:

Purity: >97.0% (by RP-HPLC, IEX-HPLC, SDS-PAGE). Less than 1% dimers and aggregates. Sterile Filtered White lyophilized (freeze-dried) powder. The ED50 as determined by the dose-dependent co-stimulation (with murine IL-4) of MC/9 cells was found to

Quelle

CHO-cells

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads daha fazla


Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu rec. Human Interleukin-10 (rHuIL-10). Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.