rmLIF - rec. Leukemia Inhibitory Factor

Leukemia Inhibitory Factor (LIF) is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone and fat metabolism, mitogenesis of factor dependent cell lines and promotion of megakaryocyte productin on vivo. Human and mouse LIF show 78% identiy in the amino acid sequence. Human LIF is as active on human cells as it is on mouse cells, though mouse LIF is about 1000 fold less active on human cell, than human LIF.

Rec. Murine Leukemia Inhibitory Factor produced in E.Coli is a single, non-glycosylated, polypeptide of 181 amino acids with a molecular mass of 20kDa.

Leukemia Inhibitory Factor is supplied as a sterile filtered white lyophilized (freeze-dried) powder. It was lyophilized from a concentrated (1mg/mL) sterile solution containing 20mM Phosphate buffer pH7.4 and 0.02% Tween-20.

The amino acid sequence is: MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF.

Biological activity: Activity of murine LIF was determined by the M1 cell differentiation assay which was found to be <0.01ng/mL, corresponding to a specific activity of 100,000,000 IU/mg. A standard of 50 Units is defined as the concentration of mouse LIF in 1.0mL of tissue culture medium that induces the differentiation of 50% of M1 colonies.

Synonmys: CDF, HILDA, D-FACTOR, Differentiation- stimulating factor, Melanoma-derived LPL inhibitor, MLPLI, Emfilermin, Leukemia inhibitory factor, LIF, DIA.

Patent Rights: The sale and/or commercial use of rec. Mouse LIF is prohibited in the United Sates of America (U.S.A.).