human LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

human LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES


Sipariş numarası: P2299.9501

Shipping: Shipment: not cooled. Store at -20°C. For laboratory usage only!

Teslim süresi yaklaşık. 5 iş günü

Miktar Birim fiyatı
Hedef 2 315,62 € *
Kaynak 3 252,49 € *

Weight:

Please select the favoured pack size.

Purity:

Please select the favoured purity.

LL-37 human LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES is a muntifunctional host defense... daha fazla
Ürün bilgileri "human LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES"

LL-37 human LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria. Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution.

Amino acid sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES (Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser)

İlgili bağlantılar "human LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES"
Bizim üzerine yorumumuz "human LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES"
Peptide purity: >95% (HPLC). Delivered as lyophilized powder.
Specifications: Purity: >70% (HPLC) Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES... daha fazla
 

Technische Daten:

Specifications:
Purity: >70% (HPLC)
Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Sequence (three letter code): Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
C205H341N61O52
MW = 4493.3 g/mol
Lyophilized white powder

Applikation:

LL-37 is used to study host defense mechanisms.

Quelle

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 32-16-04-09
Dokumente - Protokolle - Downloads daha fazla


Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu human LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.

 
 
 
MOG (35-55) Ratte/Maus MEVGWYRSPFSRVVHLYRNGK MOG (35-55) rat/mouse MEVGWYRSPFSRVVHLYRNGK
Gönderen 168,00 € * 210,00 € *
MOG (92-106) DEGGYTCFFRDHSYQ MOG (92-106) DEGGYTCFFRDHSYQ
Gönderen 168,00 € * 210,00 € *
MOG (97-108) TCFFRDHSYQEE MOG (97-108) TCFFRDHSYQEE
Gönderen 168,00 € * 210,00 € *
MOG (183-191) FVIVPVLGP MOG (183-191) FVIVPVLGP
Gönderen 116,00 € * 145,00 € *
MOG (91-108), rat SDEGGYTCFFRDHSYQEE MOG (91-108), rat SDEGGYTCFFRDHSYQEE
Gönderen 232,00 € * 290,00 € *