MAGE-A3 Peptide Pool

MAGE-A3 Peptide Pool


Sipariş numarası: P2965.70PP

Shipping: shipped at RT, store at -20°C

Teslim süresi yaklaşık. 5 iş günü

225,00 € *

Purity:

Please select the favoured purity.

MAGE-A3 Control Pool of 76peptides derived from a peptide scan (15mers with 11 aa overlap)... daha fazla
Ürün bilgileri "MAGE-A3 Peptide Pool"

MAGE-A3 Control Pool of 76peptides derived from a peptide scan (15mers with 11 aa overlap) through Melanoma-associated antigen 3 (MAGEA3) (UniProt ID: P43357) of Homo sapiens (Human) for T cell assay.

Length of Melanoma-associated antigen 3: 314amino acids
Sequence:
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEE
GPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLG
DNQIMPKAGLLIIVLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHH
MVKISGGPHISYPPLHEWVLREGEE

İlgili bağlantılar "MAGE-A3 Peptide Pool"
Specifications: Purity: >70% (HPLC) Amount: approx. 25µg of each peptide Origin/Protein:... daha fazla
 

Technische Daten:

Specifications:
Purity: >70% (HPLC)
Amount: approx. 25µg of each peptide
Origin/Protein: Melanoma-associated antigen 3
Organism: Homo sapiens (Human)
UniProtKB - P43357
lyophilized white powder

Applikation:

Usage: T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response Indication(s)/Topic(s): Cancer, Melanoma

Quelle

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads daha fazla


Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu MAGE-A3 Peptide Pool. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.

 
 
 
CMV IE-1 (199-207) - ELRRKMMYM CMV IE-1 (199-207) - ELRRKMMYM
Gönderen 72,00 € * 90,00 € *
Melan-A / MART-1 (26-35) - EAAGIGILTY - B*35:01 Melan-A / MART-1 (26-35) - EAAGIGILTY - B*35:01
Gönderen 80,00 € * 100,00 € *
[Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV [Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV
Gönderen 74,16 € * 92,70 € *