rec. humanes Interleukin-13 - rHuIL-13

IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL13 is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene together with IL3 >,IL4 >IL5 >, and CSF2 > forms a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.

Rec. human Interleukin-13 produced in E.Coli is a single, non-glycosylated polypeptide of 112 amino acids and a molecular mass of 12 kDa.

Amino acid sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIE VAQFVKDLLLHLKKLFREGRFN.

Synonyms: NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.