rec. humanes Interleukin-13 - rHuIL-13

rec. humanes Interleukin-13 - rHuIL-13


Artikel-Nr.: C6261.0002

Shipping: shipped at RT, stored at -20°C

Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

145,00 € *

Gewicht:

Wählen Sie bitte die gewünschte Packungsgröße aus.

IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL13 is involved... mehr
Produktinformationen "rec. humanes Interleukin-13 - rHuIL-13"

IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL13 is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene together with IL3 >,IL4 >IL5 >, and CSF2 > forms a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.

Rec. human Interleukin-13 produced in E.Coli is a single, non-glycosylated polypeptide of 112 amino acids and a molecular mass of 12 kDa.

Amino acid sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIE VAQFVKDLLLHLKKLFREGRFN.

Synonyms: NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.

Weitere Artikel passend zu "rec. humanes Interleukin-13 - rHuIL-13"
Specifications: Purity: min. 95% (HPLC and SDS-PAGE) Lyophilized from a sterile filtered... mehr
 

Technische Daten:

Specifications:
Purity: min. 95% (HPLC and SDS-PAGE)
Lyophilized from a sterile filtered concentrated (1mg/mL) solution with 1xPBS pH7.2, 5% trehalose
Biological activity: The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be <1ng/mL, corresponding to a specific activity of >1 x 106units/mg.

 

Quelle

Escherichia Coli

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr


Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu rec. humanes Interleukin-13 - rHuIL-13. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.