Für die Filterung wurden keine Ergebnisse gefunden!
FSL-1 (Pam2C-GDPKHPKSF) showed higher activity than MALP-2 when tested for its capability to activate THP-1 cells to produce TNF-alpha and on HEK293 cells transfected with TLR2 and TLR6 to produce NF-kappaB (Okusawa et al. 2004). It was...
472,10 € *
FSL-1 (Pam2CysGDPKHPKSF) showed higher activity than MALP-2 when tested for its capability to activate THP-1 cells to produce TNF-alpha and on HEK293 cells transfected with TLR2 and TLR6 to produce NF-kappaB (Okusawa et al. 2004). It was...
ab 238,70 € *
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
328,88 € *
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
217,48 € *

Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK > , Pam2Cys-SKKKK > or FSL-1 > are analogues or substructures of TLR2 ligands...
299,47 € *
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
217,48 € *
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
355,40 € *
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
196,27 € *
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
299,47 € *

Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
206,88 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
477,41 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
493,32 € *
Toll-like receptors 2/6 heterodimers are activated by diacylated lipoproteins and their synthetic lipopeptide analogues. All offered diacylated lipopeptides are based on L-cysteine and are provided as lyophilised powders without any...
ab 153,83 € *

Toll-like receptors 2/6 heterodimers are activated by diacylated lipoproteins and their synthetic lipopeptide analogues. All offered diacylated lipopeptides are based on L-cysteine and are provided as lyophilised powders without any...
217,48 € *

[beta]-Amyloid (1-40), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are...
ab 252,35 € *

[beta]-Amyloid (1-40), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are...
ab 386,87 € *

[beta]-Amyloid (1-40), human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques...
ab 234,04 € *

[beta]-Amyloid (1-40), human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques...
ab 386,87 € *

Kontrollpeptid Amyloid-beta (40-1) von Ratte. Charakteristisch für die Alzheimer-Krankheit ist die Anreicherung von Amyloid-Plaques im Gehirn. Die Hauptkomponenten dieser Plaques sind Amyloid-ß-Peptide mit 39-42 Aminosäuren, die durch...
ab 234,04 € *

Kontrollpeptid Amyloid-beta (40-1). Charakteristisch für die Alzheimer-Krankheit ist die Anreicherung von Amyloid-Plaques im Gehirn. Die Hauptkomponenten dieser Plaques sind Amyloid-ß-Peptide mit 39-42 Aminosäuren, die durch...
ab 234,04 € *

Biotinyliertes Amyloid-ß (1-40) Peptid. Biotinylierte Peptide sind ein nützliches Werkzeug für viele wichtige Anwendungen in der Alzheimerforschung. Biotin hat eine starke Affinität zu Avidin oder Streptavidin. Diese Wechselwirkung kann...
ab 457,92 € *

Biotinyliertes Amyloid-ß (1-40) Peptid. Biotinylierte Peptide sind ein nützliches Werkzeug für viele wichtige Anwendungen in der Alzheimerforschung. Biotin hat eine starke Affinität zu Avidin oder Streptavidin. Diese Wechselwirkung kann...
ab 457,92 € *

Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
ab 201,61 € *

Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
ab 201,61 € *
Das Peptid: NYSKMIFSHHHH ist einer von verschiedenen publizierten Inhibitoren der amyloid-beta Aggregation. Viele dieser Inhibitoren sind Fragmente und/oder modifizierte Peptide der nativen amyloid-beta Sequenz. Andere wiederum wurden...
ab 154,08 € *

Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
ab 154,08 € *

In wissenschaftlichen Experimenten induziert das MOG Peptidfragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) eine autoimmune Encephalomyelitis bei Nagetieren. Eine einzige Injektion mit diesem Peptid löst eine...
ab 146,26 € *

This Protein L-Ligand Leakage Elisa kit has been designed to detect and quantify Protein L in Immunoglobulin (Ig) or Ig-fragment containing solutions. It is a sandwich ELISA with microtiter strips coated with an affinity purified...
1.164,38 € *

The Protein L-Ligand Leakage ELISA-kit has been designed to detect and quantify Protein L in Immunoglobulin (Ig) or Ig-fragment containing solutions. It is a sandwich ELISA with microtiter strips coated with an affinity purified...
1.321,28 € *
Trypsin 1:250 aus Schweinepankreas (240 - 260 USP U/mg). Enthält Chymotrypsin, Elastase und nichtproteolytische Aktivitäten. Die native Form von Trypsin besteht aus einem einkettigen Polypeptid von 223 Aminosäureresten, das durch...
ab 113,64 € *
Collagenase aus Clostridium histolyticum ist ein Enzymgemisch aus Collagenase, Clostripain sowie tryptischen und proteolytischen Aktivitäten. Collagenase Typ I zeigt eine ausgeglichene Aktivität von Collagenase, Clostripain sowie...
ab 73,91 € * 105,59 € *
Collagenase aus Clostridium histolyticum ist ein Enzymgemisch aus Collagenase, Clostripain sowie tryptischen und proteolytischen Aktivitäten. Collagenase Typ II weißt eine hohe Clostripain-Aktivität auf. Die tryptische Aktivität...
ab 73,91 € * 105,59 € *
Collagenase aus Clostridium histolyticum ist ein Enzymgemisch aus Collagenase, Clostripain sowie tryptischen und proteolytischen Aktivitäten. Collagenase Typ III zeigt eine geringe proteolytische bei gleichzeit normaler...
ab 105,59 € *
Collagenase aus Clostridium histolyticum ist ein Enzymgemisch aus Collagenase, Clostripain sowie tryptischen und proteolytischen Aktivitäten. Collagenase Typ IV weißt eine geringe tryptische, hohe Collagenase- und normale...
ab 73,91 € * 105,59 € *
Das menschliche Choriongonadotropin (hCG) ist ein in der Schwangerschaft erzeugtes Peptidhormon, das vom Embryo bald nach der Empfängnis und später vom Syncytiotrophoblast (Teil der Plazenta) hergestellt wird. Seine Aufgabe ist es, den...
ab 150,26 € *

Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs to stimulate GH release. GHRP-2, an investigational drug, is one of the most potent...
ab 132,61 € *

Parathyroid hormone (PTH), or parathormone, is secreted by the parathyroid glands as a polypeptide of 84 amino acids. It acts to increase the concentration of calciumin in the blood, whereas calcitonin (a hormone produced by the...
ab 291,75 € *

Vitronectin is a multifunctional glycoprotein present in blood and in the extra-cellular matrix. The complete open reading frame encodes for 459 amino acids which are preceded by a 19 amino acid signal peptide. It contains three...
ab 280,75 € *

HER2/neu/ErbB-2 (human epidermal growth factor receptor 2) ist ein Membranglycoprotein der ErbB-Familie von Tyrosinkinaserezeptoren. Die Proteine dieser Gruppe (ErbB1-4) dienen als Rezeptoren der Epidermal growth Faktoren. ErbB2 wird auf...
571,73 € *

Das Epithelial Cell Adhesion Molekül (EpCAM), auch bekannt als Antigen GA733-2 ist ein 40 kDa Transmembranglycoprotein. Es besteht aus einer 242 aminosäurelangen extrazellulären Domäne (ED), einer 23 aminosäurelangen Transmembranregion...
755,44 € *

Arachis hypogaea lectin or Peanut Agglutinin (PNA) is isolated from peanuts and purified by affinity chromatography. The lectin has a molecular weight of 110 kDa and consists of four identical subunits of approximately 27 kDa each. PNA...
ab 107,81 € *
Artocarpus integrifolia lectin (Jacalin) is isolated from jackfruit seeds and purified by affinity chromatography. The lectin belongs to the family of galactose-binding lectins and has a tetrameric two-chain structure with a weight of 66...
ab 113,48 € *
Calmodulin ist ein bioaktives Protein mit dem Molgewicht 16,7 kDa das aus Rinderhoden isoliert wird. Das Material stammt aus Rindern die in Schweden geboren und heran gezüchtet wurden (Schweden ist ein BSE-freies Land). Calmodulin ist...
ab 113,48 € *

Crotalaria juncea is isolated from the Crotalaria juncea seeds. It is a glycoprotein which displays specificity toward ß-galactosides and specifically interacts with serum glycoproteins, cytochrome b5 and virus surface glycoproteins...
ab 226,96 € *
Lens culinaris lectin or agglutinin (LCA) is isolated from Lens culinaris (lentil) seeds and purified by affinity chromatography. The lectin has two subunits and a molecular weight of 46 kDa and it forms a complex together with sucrose....
ab 97,85 € *

Narcissus pseudonarcissus Lektin (NPL) wird aus Narzissen isoliert. Das Protein ist im nativen Zustand ein Homodimer von 26 kDa. Die Untereinheiten haben somit ein MW von 13 kDa. NPL zeigt eine Spezifität gegen alphaverknüpfte Mannose....
ab 226,97 € *
Galanthus nivalis lectin or agglutinin (GNA) is isolated from snowdrop bulbs. It has a molecular weight of 50 kDa and consists of four identical subunits. The lectin is known to agglutinate rabbit erythrocytes but not human erythrocytes....
ab 106,61 € * 115,00 € *

Phaseolus vulgaris Lectin E (PHA-E) wird aus Red Kidney Bohnen gewonnen und mittels Affinitäts- und Ionenaustauschchromatographie gereinigt. Es ist ein tetrameres Protein mit einem Molekulargewicht von 128kDa. Das Lectin erkennt und...
ab 113,48 € *

Phaseolus vulgaris Lectin P (PHA-P) wird aus Red Kidney Bohnen gewonnen und mittels Affinitäts- und Ionenaustauschchromatographie gereinigt. Das Lectin besteht aus 2 Untereinheiten von PHA-E und PHA-L und stellt somit die Vorstufe von...
ab 109,22 € *

Phaseolus vulgaris Lectin L (PHA-L) wird aus Red Kidney Bohnen gewonnen und mittels Affinitätschromatographie gereinigt. Es ist ein tetrameres Protein mit einem Molekulargewicht von 126kDa und 31kDa von jeder Untereinheit. Das Lectin...
ab 79,44 € *
Lyophilisiertes Pulver von Lektin aus Triticum vulgaris (WGA). WGA ist nicht blutgruppenspezifisch, zeigt aber eine Affinität zu N-acetyl-β-D-glucosaminyl-Resten und N-acetyl-β-D-glucosamin Oligomeren. WGA besitzt keine proteingebundenen...
ab 107,81 € *

Vicia ervilia lectin or agglutinin (VEA) is isolated from bitter vetch seeds and has a molecular weight of 53 kDa. This lectin is blood group non-specific with sugar specificity for α-mannose and, to a lesser extent, α-glucose residues...
ab 211,15 € *

Endothelial Mitogen can be used for Human & Mammalian Vascular Endothelial Cells at concentration of 0.1-0.3mg/mL of serum supplemented media & 0.01-0.1mg with heparin (Some primary cells require supplementation of 1-100µg/mL heparin)....
ab 191,28 € *

Das acetylierte Albumin wird besonders für alle molekularbiologischen Anwendungen empfohlen. Im Herstellungsprozess werden Essigsäureanhydrid und chaotropische Agenzien eingesetzt, die jegliche Nuklease und Proteaseaktivität zerstören.
ab 140,30 € *

Kristallisiertes Albumin ist ein Albumin Fraktion V, das dreimal bei Temperaturen unter 0°C umkristallisiert wurde. Dadurch enthält man ein sehr natives Protein, das frei von Kohlehydraten, Globulinen und Fettsäuren ist.
ab 101,33 € *

Kompatibel mit vielen diagnostischen Enzymen und Komponenten. Hauptsächlich monomeres Albumin. IgGs nicht detektierbar.
ab 67,54 € *

Rinderserumalbumin (BSA) Fraction V (pH 7,0) ist ein lyphilisiertes Albumin der Standardreinheit. Serumalbumin vom Rind (BSA) wird häufig zur Stabilisierung von Proteinen den entsprechenden Puffern zugesetzt. Die Konzentration liegt in...
ab 65,03 € *

Albumin aus Hühnereiweiß (Ovalbumin) ist ein phosphoryliertes Glycoprotein das 385 Aminosäurereste enthält und ein Molekulargewicht von 42,7 kDa besitzt. Hühnereiweiß ist der mengenmäßig größte Proteinbestandteil von Eiklar. Wird in der...
ab 215,51 € *

Albumin aus Hühnerei (Ovalbumin). Rohextrakt: mind. 80% Proteingehalt.
ab 59,17 € *

Rinderalbumin mit spezieller Reinheit für die Mikrobiologie. Besonders geeignet für z.B. Mycobacterien, Trypanosomen, Mycoplasmen, etc.. Application and characteristics Typically used for manufacturing and in immunodiagnostic assays such...
ab 56,04 € *

Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
ab 270,19 € *

ß-Agarase wird für die Isolierung reiner DNA und RNA aus niedrig schmelzender Agarose benutzt (Ishumatsu K. et al. (1956) Sci. and Ind. (Japan), 30, 137). Eine ß-Agarase unit löst 500mg einer niedrig schmelzenden Agarose bei 40-42°C...
264,10 € *

Diese Katalase stammt aus einem gentechnish veränderten Stamm von Aspergillus niger. Das Enzym ist im pH-Bereich von 4,0-8,0 aktiv und hat ihr Optimum bei pH 5,5. Catalase zeigt im Temperaturbereich von 30°C bis 65°C Aktivität, wobei das...
67,93 € *

Diese Katalase stammt aus einem gentechnish veränderten Stamm von Aspergillus niger. Das Enzym ist im pH-Bereich von 4,0-8,0 aktiv und hat ihr Optimum bei pH 5,5. Catalase zeigt im Temperaturbereich von 30°C bis 65°C Aktivität, wobei das...
152,90 € *

alpha-Chymotrypsin ist eine Serinprotease die Peptidbindungen mit aromatischen oder großen hydrophoben Seitenketten (Tyr, Trp, Phe, Leu) am Carboxyende spaltet. Dabei aktiviert und stabilisieren Ca2+ Ionen das Enzym. alpha-Chymotrypsin...
ab 63,88 € *
Lipasen sind Enzyme, die von Lipiden wie Glyceriden oder Cholesterinestern freie Fettsäuren abspalten (Lipolyse). Diese Enzyme spielen physiologisch eine wichtige Rolle, indem sie Fette verdauen und so die im Körper gespeicherten...
ab 96,71 € *
Lysozym hydrolysiert bevorzugt die β-1,4-glykosidische Bindung zwischen N-Acetylmuraminsäure und N-Acetyl-D-glucosamin, Bestandteile der Proteoglycan-Zellwand bestimmter Mikroorganismen, und baut die Heteroglycankette zu Disacchariden...
ab 33,22 € *

Pankreatin ist ein enzymatisch komplexes Gemisch von Wirkstoffen die aus der Bauchspeicheldrüse von Hausschweinen gewonnen werden.
ab 44,86 € *

Papain gehört zu den proteolytischen Enzymen, die eine freie Sulfhydryl-Gruppe für die Aktivität brauchen (Gruppe der Cystein-Proteasen). Das pH-Optimum von Papain liegt bei pH6 und das Temperatur-Optimum bei 65°C. Beim isoelektrischen...
34,32 € *
Pepsin aus Schweinemagen. Seine inaktive Vorstufe ist das von den Hauptzellen der Magenschleimhaut sezernierte Pepsinogen. Pepsinogen wird bei einem sauren pH-Wert unter 3 in das proteolytisch wirksame Pepsin gespalten. Pepsin gehört zu...
ab 35,86 € *
TEV-Protease ist eine hochspezifische Cysteinprotease aus dem Tobacco Etch Virus (TEV). Aufgrund ihrer hohen Sequenzabhängigkeit ist die TEV-Protease spezifischer als Faktor Xa, Thrombin oder Enterokinase. Damit ist die TEV-Protease ein...
ab 161,52 € *

Serratia nuclease is a non-specific enzyme that cleaves all forms of DNA and RNA very efficiently. It is commonly used on biological material for the quantitative removal of nucleic acids and for viscosity reduction. The nuclease can be...
589,65 € *

Meerrettichperoxidase (HRP) aus Meerrettichextrakten wird intensiv in der Molekularbiologie, der Antikörperdetektion (ELISA) und weiteren Anwendungen eingesetzt. Meerrettichperoxidase wird sehr häufig bei den folgenden Anwendungen...
77,75 € *
Meerrettichperoxidase (HRP) aus Meerrettichextrakten wird intensiv in der Molekularbiologie, der Antikörperdetektion (ELISA) und weiteren Anwendungen eingesetzt. Meerrettichperoxidase wird sehr häufig bei den folgenden Anwendungen...
ab 164,44 € *
L-Asparaginase is an enzyme that depletes L-Asparagine an important nutrient for cancer cells resulting in cancer/tumor cell starvation. L-asparaginase is an anti-tumor agent derived from E.coli., which can inhibit the growth of...
ab 181,30 € *
Lysostaphin, eine spezifische Endopeptidase für Zellwandpeptidoglycane von Staphylococci , ist ein extrem potentes anti- Staphylococcus Reagenz. Lysostaphin wird in der Diagnostik und Forschung eingesetzt. Weil es Staphylococci sehr...
ab 170,89 € *

Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie Peptiden, Proteinen, Nukleinsäuren und Nanopartikeln zu fördern. CPPs sind...
ab 279,13 € *

Nona-D-Arginin (r9, bzw. Sequenz: rrrrrrrrr) gehört zur Gruppe der zellpenetrierenden Peptiden (CPPs), die durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie Peptiden,...
ab 279,41 € *
Concanavalin A is a member of a group of proteins called lectins which are proteins that react with specific sugar residues. It has broad applicability and is the most widely used lectin within molecular biology research. The...
ab 64,00 € *

Trypsin aus Rinderpankreas, min. 2500 U/mg (nach BAEE) lyophilisiert. Enthält ca. 0.1% Chymotrypsin, Elastase und nichtproteolytische Aktivitäten. Einheiten-Definition: Die Enzymmenge, die einen Anstieg der Absorption bei 253 nm von...
ab 76,20 € *

Chymotrypsinogen ist der praktisch inakive "Precursor" (Proenzym, oder auch Zymogen) von Chymotrypsin. Um aktiviert zu werden, muss Chymotrypsinogen zwischen den Aminosäuren Arginin und Isoleucin (R15 und I16) durch Trypsin gespalten...
365,65 € *

Diese Katalase stammt aus einem gentechnish veränderten Stamm von Aspergillus niger. Das Enzym ist im pH-Bereich von 4,0-8,0 aktiv und hat ihr Optimum bei pH 5,5. Catalase zeigt im Temperaturbereich von 30°C bis 65°C Aktivität, wobei das...
ab 162,48 € *

Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie Peptiden, Proteinen, Nukleinsäuren und Nanopartikeln zu fördern. CPPs sind...
ab 152,00 € * 160,00 € *

CPPs, wie CyloP-1, werden im Allgemeinen von endozytotischen Pfaden aufgenommen wobei die vesikuläre Verkapselung sich als limitierender Faktor im Bereich des intrazellulären Targeting darstellt. CyLoP-1, wurde entwickelt, weil es eine...
ab 149,85 € *

Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie Peptiden, Proteinen, Nukleinsäuren und Nanopartikeln zu fördern. CPPs sind...
ab 181,02 € * 185,00 € *

Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie Peptiden, Proteinen, Nukleinsäuren und Nanopartikeln zu fördern. CPPs sind...
ab 72,25 € * 85,00 € *

Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie Peptiden, Proteinen, Nukleinsäuren und Nanopartikeln zu fördern. CPPs sind...
ab 152,00 € * 160,00 € *

Influenza A MP (58-66) HLA-A*02:01 GILGFVFTL T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der Regel Peptide mit einer Größe zwischen 8 und 11...
ab 85,50 € * 90,00 € *

HIV-1 p17 Gag (77-85) - SLYNTVATL gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der Regel Peptide mit einer...
ab 85,50 € * 90,00 € *

T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der Regel Peptide mit einer Größe zwischen 8 und 11 Aminosäuren und zeigen MHC-spezifische...
ab 88,07 € * 90,00 € *

Melan-A / MART-1 (26-35) - EAAGIGILTV gehört zur Gruppe der T-Zell-Epitop-Peptide. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der Regel Peptide...
ab 85,50 € * 90,00 € *
LCMV GP (33-41) mit der Peptidsequenz KAVYNFATM ist ein T-Zell-Epitop-Peptid, das auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert wird. T-Zell-Epitope sind in der Regel Peptide mit einer Größe...
ab 88,07 € * 90,00 € *

Influenza A NP (366-374) H-2 Db ASNENMETM. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der Regel Peptide mit einer Größe zwischen 8 und 11...
ab 85,50 € * 90,00 € *

MAGE-A3 (271-279) FLWGPRALV Antigen gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der Regel Peptide mit...
ab 85,50 € * 90,00 € *
Ova (257-264) - SIINFEKL gehört zu den T-Zell-Epitop-Peptiden.Ovalbumin (257-264) aus Huhn wird benutzt um die T-Zell. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese...
ab 93,50 € * 110,00 € *

Ova (323-339) ISQAVHAAHAEINEAGR gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der Regel Peptide mit einer...
ab 153,83 € *

Das pan-HLA-DR-bindende Epitop (PADRE - Peptid AKFVAAWTLKAAA) wurde als ein einfaches Epitoppeptid vorgeschlagen, das für die Entwicklung von synthetischen und rekombinanten Impfstoffen geeignet sein könnte. T-Zell-Epitope werden auf der...
ab 164,40 € * 205,50 € *

MBP (1-11) Human - Ac-ASQKRPSQRHG repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist...
ab 171,00 € * 185,00 € *

MBP (54-72) Human - SHHAARTTHYGSLPQKSQR repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS)...
ab 251,75 € * 270,00 € *

PLP (139 - 151) - HCLGKWLGHPDKF repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 140,25 € * 165,00 € *

PLP (178-191) - NTWTTCQSIAFPSK repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 144,00 € *

In wissenschaftlichen Experimenten induziert das MOG Peptidfragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) eine autoimmune Encephalomyelitis bei Nagetieren. Eine einzige Injektion mit diesem Peptid löst eine...
ab 166,50 € * 185,00 € *

MOG (91-108) SDEGGYTCFFRDHSYQEE repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 223,25 € * 235,00 € *

MOG (183-191) FVIVPVLGP repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 85,50 € * 90,00 € *

MOG (97-108) TCFFRDHSYQEE repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 175,75 € * 185,00 € *

MOG (92-106) DEGGYTCFFRDHSYQ repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 148,32 € *

RIIGL is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches....
ab 153,83 € *

The KLVFF peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display...
92,70 € *
alpha-Chymotryp humanes LL-37 Phaseolus Papain PADRE - Albumin aus rek. Ova 257-264 gp100 280-288 Heparin HCV NS5B Collagenase Typ Pam2Cys-SKKKK Amyloid-beta Pankreatin MAGE-A4 230 239 GHRP-6 Human Chorionic CMV pp65 HIV-1 p17 Gag Trypsin aus Pepsin EC CMV pp65 SARS-CoV-2 Ova 323-339 Rinderserumalbu HIV-1 TAT 47-57 CMV IE-1 99-107 Collagenase Typ Lysozym aus