Peptide & Proteine

Peptide für die Forschung von z. B. Alzheimer, Multiple Sklerose, Apoptose oder Krebs.

Genaxxon bioscience bietet Peptide für verschiedene Forschungsgebiete als schnell lieferbare Lagerware an. Diese Lagerpeptide kommen aus den Forschungsfeldern: Lipopeptide, MHC-Peptide, MS-Peptide, Alzheimer-Peptide/Neuroscience, Krebs & Apoptose und Cell Penetrating Peptide (CPP). Wir synthetisieren Peptide natürlich auch auf Kundenwunsch. Als DIN ISO 9001-2015-zertifizierte Firma bieten wir unseren Kunden höchste Qualität bei den von uns gelieferten Peptiden. Dabei umfasst das Produktportfolio Standardpeptide mit einer Reinheit von 70% bis >95% und von 1mg bis 1g, aber auch isotopenmarkierte Peptide, immunogene Peptide, Peptide mit posttranslationalen Modifikationen, Peptide mit Fluoreszenzlabel, Biotin oder anderen Modifikationen.

Für unsere Kunden, die auf Gebieten wie Alzheimer´s Disease, Multiple Sklerose oder immunogenen Defekten arbeiten, bieten wir Peptide als Lagerware höchster Qualität an. Siehe: Cell Penetrating Peptide >, MHC-I und MCH-II Peptide >, Peptide für die Alzheimerforschung > oder Multiple Sklerose >.

Zusätzlich erhalten Sie von Genaxxon eine breite Palette an Lipopeptiden >, die als Teil der äußeren Membran von Gram-negativen und Gram-positiven Bakterien und Mykoplasmen vorkommen und als Zellaktivierungssignale über sogenannte "toll like receptors" agieren.

Peptide für die Forschung von z. B. Alzheimer, Multiple Sklerose, Apoptose oder Krebs. Genaxxon bioscience bietet Peptide für verschiedene Forschungsgebiete als schnell lieferbare... mehr erfahren »
Fenster schließen
Peptide & Proteine

Peptide für die Forschung von z. B. Alzheimer, Multiple Sklerose, Apoptose oder Krebs.

Genaxxon bioscience bietet Peptide für verschiedene Forschungsgebiete als schnell lieferbare Lagerware an. Diese Lagerpeptide kommen aus den Forschungsfeldern: Lipopeptide, MHC-Peptide, MS-Peptide, Alzheimer-Peptide/Neuroscience, Krebs & Apoptose und Cell Penetrating Peptide (CPP). Wir synthetisieren Peptide natürlich auch auf Kundenwunsch. Als DIN ISO 9001-2015-zertifizierte Firma bieten wir unseren Kunden höchste Qualität bei den von uns gelieferten Peptiden. Dabei umfasst das Produktportfolio Standardpeptide mit einer Reinheit von 70% bis >95% und von 1mg bis 1g, aber auch isotopenmarkierte Peptide, immunogene Peptide, Peptide mit posttranslationalen Modifikationen, Peptide mit Fluoreszenzlabel, Biotin oder anderen Modifikationen.

Für unsere Kunden, die auf Gebieten wie Alzheimer´s Disease, Multiple Sklerose oder immunogenen Defekten arbeiten, bieten wir Peptide als Lagerware höchster Qualität an. Siehe: Cell Penetrating Peptide >, MHC-I und MCH-II Peptide >, Peptide für die Alzheimerforschung > oder Multiple Sklerose >.

Zusätzlich erhalten Sie von Genaxxon eine breite Palette an Lipopeptiden >, die als Teil der äußeren Membran von Gram-negativen und Gram-positiven Bakterien und Mykoplasmen vorkommen und als Zellaktivierungssignale über sogenannte "toll like receptors" agieren.

Filter schließen
 
  •  
  •  
von bis
1 von 21
Für die Filterung wurden keine Ergebnisse gefunden!
[Ala13] Apelin QRPRLSHKGPMPA
[Ala13] Apelin QRPRLSHKGPMPA
Apelin (auch als APLN bekannt) ist ein Peptid, das beim Menschen vom APLN-Gen kodiert wird. Es ist in verschiedenen Organen wie Herz, Lunge, Niere, Leber, Fettgewebe, Magen-Darm-Trakt, Gehirn, Nebennieren, Endothel und menschlichem...
ab 180,50 € * 190,00 € *
[Ala9] Autocamtide 2 KKALRRQEAVDAL
[Ala9] Autocamtide 2 KKALRRQEAVDAL
ab 171,00 € * 180,00 € *
[beta]-Amyloid (10-20) - YEVHHQKLVFF
[beta]-Amyloid (10-20) - YEVHHQKLVFF
[beta]-Amyloid (10-20) (peptide sequence: YEVHHQKLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-42 peptide. Amyloid-beta (1-42) human is an Alzheimer desease peptide. Characteristic of Alzheimer...
200,85 € *
[Des-octanoyl]-Ghrelin, human GSSFLSPEHQRVQQRKESKKPPAKLQPR
[Des-octanoyl]-Ghrelin, human...
Ghrelin für engl. "Growth Hormone Release Inducing" ist ein appetitanregendes Hormon, welches in der Magenschleimhaut und der Bauchspeicheldrüse produziert wird. Neben der Appetitanregung hat das Hormon eine Reihe anderer Wirkungen....
ab 318,25 € * 335,00 € *
[Des-octanoyl]-Ghrelin, rat GSSFLSPEHQKAQQRKESKKPPAKLQPR
[Des-octanoyl]-Ghrelin, rat...
Ghrelin für engl. "Growth Hormone Release Inducing" ist ein appetitanregendes Hormon, welches in der Magenschleimhaut und der Bauchspeicheldrüse produziert wird. Neben der Appetitanregung hat das Hormon eine Reihe anderer Wirkungen....
ab 318,25 € * 335,00 € *
[Phe17] Apelin KFRRQRPRLSHKGPMPF
[Phe17] Apelin KFRRQRPRLSHKGPMPF
Apelin (auch als APLN bekannt) ist ein Peptid, das beim Menschen vom APLN-Gen kodiert wird. Es ist in verschiedenen Organen wie Herz, Lunge, Niere, Leber, Fettgewebe, Magen-Darm-Trakt, Gehirn, Nebennieren, Endothel und menschlichem...
ab 226,10 € * 238,00 € *
3x FLAG Peptid - DYKDDDDK-DYKDDDDK-MDYKDDDDK
3x FLAG Peptid - DYKDDDDK-DYKDDDDK-MDYKDDDDK
Das DYKDDDDK-Peptid (Peptidsequenz: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, inklusive einer Enterokinase-Schnittstelle) wurde speziell für die Immunaffinitätschromatographie entwickelt. Das Peptid erlaubt die kompetitive Elution von Proteinen...
ab 275,50 € * 290,00 € *
Ac-KLVFF-NH2
Ac-KLVFF-NH2
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
ab 149,59 € *
ACTH (1-10), human SYSMEHFRWG
ACTH (1-10), human SYSMEHFRWG
ACTH (1-10), human SYSMEHFRWG ist ein synthetisches Peptid entsprechend den ersten 10 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde. Insbesondere stimuliert...
ab 85,50 € * 90,00 € *
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF ist ein synthetisches Peptid entsprechend den Aminosäuren 18 bis 39 des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde....
ab 261,25 € * 275,00 € *
ACTH (4-10), human MEHFRWG
ACTH (4-10), human MEHFRWG
ACTH (4-10), human MEHFRWG ist ein synthetisches Peptid entsprechend den Aminosäuren 4 bis 10 des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde. Insbesondere stimuliert es...
ab 85,50 € * 90,00 € *
ACTH(1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
ACTH(1-39), human...
ACTH(1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ist ein synthetisches Peptid entsprechend den ersten 39 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die...
ab 441,75 € * 465,00 € *
1 von 21