Peptide & Proteine

Peptide und Proteine für die Forschung von z. B. Covid-19, Alzheimer, Multiple Sklerose, Apoptose oder Krebs.

Der aktuelle COVID-19-Ausbruch führt zu einer dringenden Nachfrage nach SARS-CoV-2-verwandten Produkten, die die Definition immunrelevanter Antigene und die Identifizierung von B- und T-Zell-Epitopen sowie die Entwicklung immuntherapeutischer Strategien und Instrumente für die Antigen-spezifische Immunüberwachung ermöglichen. Als Reaktion biete Genaxxon ein SARS-CoV-2-Glykoprotein an, das für die Membranfusion verantwortlich ist und daher für den Viruseintritt und die Zellfusion erforderlich ist.

Sie können dieses Protein über unseren Shop bestellen (> S5340.0100) oder ein Angebot anfordern.

Um unsere Kapazitäten optimal einsetzen zu können,  freuen wir uns über Ihr Feedback zu Ihrem erwarteten Bedarf an größeren Mengen oder höheren Reinheiten.

Genaxxon bioscience bietet Peptide für verschiedene Forschungsgebiete als schnell lieferbare Lagerware an. Diese Lagerpeptide kommen aus den Forschungsfeldern: Lipopeptide, MHC-Peptide, MS-Peptide, Alzheimer-Peptide/Neuroscience, Krebs & Apoptose und Cell Penetrating Peptide (CPP). Wir synthetisieren Peptide natürlich auch auf Kundenwunsch. Als DIN ISO 9001-2015-zertifizierte Firma bieten wir unseren Kunden höchste Qualität bei den von uns gelieferten Peptiden. Dabei umfasst das Produktportfolio Standardpeptide mit einer Reinheit von 70% bis >95% und von 1mg bis 1g, aber auch isotopenmarkierte Peptide, immunogene Peptide, Peptide mit posttranslationalen Modifikationen, Peptide mit Fluoreszenzlabel, Biotin oder anderen Modifikationen.

Für unsere Kunden, die auf Gebieten wie Alzheimer´s Disease, Multiple Sklerose oder immunogenen Defekten arbeiten, bieten wir Peptide als Lagerware höchster Qualität an. Siehe: Cell Penetrating Peptide >, MHC-I und MCH-II Peptide >, Peptide für die Alzheimerforschung > oder Multiple Sklerose >.

Zusätzlich erhalten Sie von Genaxxon eine breite Palette an Lipopeptiden >, die als Teil der äußeren Membran von Gram-negativen und Gram-positiven Bakterien und Mykoplasmen vorkommen und als Zellaktivierungssignale über sogenannte "toll like receptors" agieren.

Peptide und Proteine für die Forschung von z. B. Covid-19, Alzheimer, Multiple Sklerose, Apoptose oder Krebs. Der aktuelle COVID-19-Ausbruch führt zu einer dringenden Nachfrage nach... mehr erfahren »
Fenster schließen
Peptide & Proteine

Peptide und Proteine für die Forschung von z. B. Covid-19, Alzheimer, Multiple Sklerose, Apoptose oder Krebs.

Der aktuelle COVID-19-Ausbruch führt zu einer dringenden Nachfrage nach SARS-CoV-2-verwandten Produkten, die die Definition immunrelevanter Antigene und die Identifizierung von B- und T-Zell-Epitopen sowie die Entwicklung immuntherapeutischer Strategien und Instrumente für die Antigen-spezifische Immunüberwachung ermöglichen. Als Reaktion biete Genaxxon ein SARS-CoV-2-Glykoprotein an, das für die Membranfusion verantwortlich ist und daher für den Viruseintritt und die Zellfusion erforderlich ist.

Sie können dieses Protein über unseren Shop bestellen (> S5340.0100) oder ein Angebot anfordern.

Um unsere Kapazitäten optimal einsetzen zu können,  freuen wir uns über Ihr Feedback zu Ihrem erwarteten Bedarf an größeren Mengen oder höheren Reinheiten.

Genaxxon bioscience bietet Peptide für verschiedene Forschungsgebiete als schnell lieferbare Lagerware an. Diese Lagerpeptide kommen aus den Forschungsfeldern: Lipopeptide, MHC-Peptide, MS-Peptide, Alzheimer-Peptide/Neuroscience, Krebs & Apoptose und Cell Penetrating Peptide (CPP). Wir synthetisieren Peptide natürlich auch auf Kundenwunsch. Als DIN ISO 9001-2015-zertifizierte Firma bieten wir unseren Kunden höchste Qualität bei den von uns gelieferten Peptiden. Dabei umfasst das Produktportfolio Standardpeptide mit einer Reinheit von 70% bis >95% und von 1mg bis 1g, aber auch isotopenmarkierte Peptide, immunogene Peptide, Peptide mit posttranslationalen Modifikationen, Peptide mit Fluoreszenzlabel, Biotin oder anderen Modifikationen.

Für unsere Kunden, die auf Gebieten wie Alzheimer´s Disease, Multiple Sklerose oder immunogenen Defekten arbeiten, bieten wir Peptide als Lagerware höchster Qualität an. Siehe: Cell Penetrating Peptide >, MHC-I und MCH-II Peptide >, Peptide für die Alzheimerforschung > oder Multiple Sklerose >.

Zusätzlich erhalten Sie von Genaxxon eine breite Palette an Lipopeptiden >, die als Teil der äußeren Membran von Gram-negativen und Gram-positiven Bakterien und Mykoplasmen vorkommen und als Zellaktivierungssignale über sogenannte "toll like receptors" agieren.

Filter schließen
von bis
1 von 3
Für die Filterung wurden keine Ergebnisse gefunden!
FSL-1 TLR2/TLR6 Agonist FSL-1 TLR2/TLR6 Agonist
FSL-1 (Pam2C-GDPKHPKSF) showed higher activity than MALP-2 when tested for its capability to activate THP-1 cells to produce TNF-alpha and on HEK293 cells transfected with TLR2 and TLR6 to produce NF-kappaB (Okusawa et al. 2004). It was...
472,10 € *
FSL-1 FLAG-tag TLR2/TLR6 Agonist FSL-1 FLAG-tag TLR2/TLR6 Agonist
FSL-1 (Pam2CysGDPKHPKSF) showed higher activity than MALP-2 when tested for its capability to activate THP-1 cells to produce TNF-alpha and on HEK293 cells transfected with TLR2 and TLR6 to produce NF-kappaB (Okusawa et al. 2004). It was...
ab 238,70 € *
Lipopeptid Pam-Dhc-GDPKHPKSF Lipopeptid Pam-Dhc-GDPKHPKSF
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
328,88 € *
Lipopeptid Pam-Dhc-SKKKK Lipopeptid Pam-Dhc-SKKKK
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
217,48 € *
Lipopeptid GDPKHPKSF Lipopeptid GDPKHPKSF
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK > , Pam2Cys-SKKKK > or FSL-1 > are analogues or substructures of TLR2 ligands...
299,47 € *
Lipopeptid PamCSKKKK Lipopeptid PamCSKKKK
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
217,48 € *
Lipopeptide PamCGDPKHPKSF Lipopeptide PamCGDPKHPKSF
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
355,40 € *
Lipopeptid Dhc-SKKKK Lipopeptid Dhc-SKKKK
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
196,27 € *
Lipopeptid Dhc-GDPKHPKSF Lipopeptid Dhc-GDPKHPKSF
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
299,47 € *
Lipopeptid SKKKK Lipopeptid SKKKK
Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
206,88 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
482,71 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
477,41 € *
The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
493,32 € *
Lipopeptide Pam2Cys-SKKKK Pam2Cys-SKKKK
Toll-like receptors 2/6 heterodimers are activated by diacylated lipoproteins and their synthetic lipopeptide analogues. All offered diacylated lipopeptides are based on L-cysteine and are provided as lyophilised powders without any...
ab 153,83 € *
Toll-like receptors 2/6 heterodimers are activated by diacylated lipoproteins and their synthetic lipopeptide analogues. All offered diacylated lipopeptides are based on L-cysteine and are provided as lyophilised powders without any...
217,48 € *
Amyloid-beta (1-40) Ratte Amyloid-beta (1-40) Ratte
[beta]-Amyloid (1-40), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are...
ab 252,35 € *
Amyloid-beta (1-40) Ratte (HCl Salz) Amyloid-beta (1-40) Ratte (HCl Salz)
[beta]-Amyloid (1-40), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are...
ab 386,87 € *
Amyloid-beta (1-40). human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Amyloid-beta (1-40). human...
[beta]-Amyloid (1-40), human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques...
ab 234,04 € *
Amyloid-beta (1-40) human (HCl Salz) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Amyloid-beta (1-40) human (HCl Salz)...
[beta]-Amyloid (1-40), human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques...
ab 386,87 € *
Kontrollpeptid Amyloid-beta (40-1) Ratte Kontrollpeptid Amyloid-beta (40-1) Ratte
Kontrollpeptid Amyloid-beta (40-1) von Ratte. Charakteristisch für die Alzheimer-Krankheit ist die Anreicherung von Amyloid-Plaques im Gehirn. Die Hauptkomponenten dieser Plaques sind Amyloid-ß-Peptide mit 39-42 Aminosäuren, die durch...
ab 234,04 € *
Kontrollpeptid Amyloid-beta (40-1) human Kontrollpeptid Amyloid-beta (40-1) human
Kontrollpeptid Amyloid-beta (40-1). Charakteristisch für die Alzheimer-Krankheit ist die Anreicherung von Amyloid-Plaques im Gehirn. Die Hauptkomponenten dieser Plaques sind Amyloid-ß-Peptide mit 39-42 Aminosäuren, die durch...
ab 234,04 € *
Biotinyliertes Amyloid-beta (1-40) Ratte Biotinyliertes Amyloid-beta (1-40) Ratte
Biotinyliertes Amyloid-ß (1-40) Peptid. Biotinylierte Peptide sind ein nützliches Werkzeug für viele wichtige Anwendungen in der Alzheimerforschung. Biotin hat eine starke Affinität zu Avidin oder Streptavidin. Diese Wechselwirkung kann...
ab 457,92 € *
Biotinyliertes Amyloid-beta (1-40) human Biotinyliertes Amyloid-beta (1-40) human
Biotinyliertes Amyloid-ß (1-40) Peptid. Biotinylierte Peptide sind ein nützliches Werkzeug für viele wichtige Anwendungen in der Alzheimerforschung. Biotin hat eine starke Affinität zu Avidin oder Streptavidin. Diese Wechselwirkung kann...
ab 457,92 € *
qshyrhispaqv (D-Aminosäuren) qshyrhispaqv (D-Aminosäuren)
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
ab 201,61 € *
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
ab 201,61 € *
Das Peptid: NYSKMIFSHHHH ist einer von verschiedenen publizierten Inhibitoren der amyloid-beta Aggregation. Viele dieser Inhibitoren sind Fragmente und/oder modifizierte Peptide der nativen amyloid-beta Sequenz. Andere wiederum wurden...
ab 154,08 € *
Amyloid inhibitor peptide - HNHKLVFFHHQH Amyloid inhibitor peptide - HNHKLVFFHHQH
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
ab 154,08 € *
In wissenschaftlichen Experimenten induziert das MOG Peptidfragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) eine autoimmune Encephalomyelitis bei Nagetieren. Eine einzige Injektion mit diesem Peptid löst eine...
ab 146,26 € *
Protein L-Ligand Leakage Elisa Kit Protein L-Ligand Leakage Elisa Kit
This Protein L-Ligand Leakage Elisa kit has been designed to detect and quantify Protein L in Immunoglobulin (Ig) or Ig-fragment containing solutions. It is a sandwich ELISA with microtiter strips coated with an affinity purified...
1.164,38 € *
Protein L-Ligand Leakage Elisa XL Protein L-Ligand Leakage Elisa XL
The Protein L-Ligand Leakage ELISA-kit has been designed to detect and quantify Protein L in Immunoglobulin (Ig) or Ig-fragment containing solutions. It is a sandwich ELISA with microtiter strips coated with an affinity purified...
1.321,28 € *
Trypsin from porcine pancreas Trypsin aus Schweinepankreas (1:250)
Trypsin 1:250 aus Schweinepankreas (240 - 260 USP U/mg). Enthält Chymotrypsin, Elastase und nichtproteolytische Aktivitäten. Die native Form von Trypsin besteht aus einem einkettigen Polypeptid von 223 Aminosäureresten, das durch...
ab 113,64 € *
Collagenase Type I - with a balanced activity of collagenase, clostripain as well as tryptic and proteolytic Collagenase Typ I (EC >100 units/mg
Collagenase aus Clostridium histolyticum ist ein Enzymgemisch aus Collagenase, Clostripain sowie tryptischen und proteolytischen Aktivitäten. Collagenase Typ I zeigt eine ausgeglichene Aktivität von Collagenase, Clostripain sowie...
ab 73,91 € * 105,59 € *
Collagenase Type II - high clostripain activity Collagenase Typ II (EC >180 units/mg
Collagenase aus Clostridium histolyticum ist ein Enzymgemisch aus Collagenase, Clostripain sowie tryptischen und proteolytischen Aktivitäten. Collagenase Typ II weißt eine hohe Clostripain-Aktivität auf. Die tryptische Aktivität...
ab 73,91 € * 105,59 € *
Collagenase Type III - normal Collagenase, but very low proteolytic activity Collagenase Typ III (EC
Collagenase aus Clostridium histolyticum ist ein Enzymgemisch aus Collagenase, Clostripain sowie tryptischen und proteolytischen Aktivitäten. Collagenase Typ III zeigt eine geringe proteolytische bei gleichzeit normaler...
ab 175,00 € *
Collagenase IV - low tryptic, high collagenase and normal clostripain activity. Collagenase Typ IV (EC >900 units/mg
Collagenase aus Clostridium histolyticum ist ein Enzymgemisch aus Collagenase, Clostripain sowie tryptischen und proteolytischen Aktivitäten. Collagenase Typ IV weißt eine geringe tryptische, hohe Collagenase- und normale...
ab 73,91 € * 105,59 € *
human chorionic gonadotropin - hCG Human Chorionic Gonadotropin (hCG)
Das menschliche Choriongonadotropin (hCG) ist ein in der Schwangerschaft erzeugtes Peptidhormon, das vom Embryo bald nach der Empfängnis und später vom Syncytiotrophoblast (Teil der Plazenta) hergestellt wird. Seine Aufgabe ist es, den...
ab 150,26 € *
hGHRP-2 / Human Growth Hormone Releasing Peptide-2 hGHRP-2 / Human Growth Hormone Releasing Peptide-2
Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs to stimulate GH release. GHRP-2, an investigational drug, is one of the most potent...
ab 132,61 € *
rhuPTH - rekombinantes humanes Parathyroidhormon (aa 1-34) rhuPTH - rekombinantes humanes...
Parathyroid hormone (PTH), or parathormone, is secreted by the parathyroid glands as a polypeptide of 84 amino acids. It acts to increase the concentration of calciumin in the blood, whereas calcitonin (a hormone produced by the...
ab 291,75 € *
rHu Vitronectin rHu Vitronectin
Vitronectin is a multifunctional glycoprotein present in blood and in the extra-cellular matrix. The complete open reading frame encodes for 459 amino acids which are preceded by a 19 amino acid signal peptide. It contains three...
ab 280,75 € *
rHu HER2-ECD / humanes ErbB2/Her2 Herstatin rHu HER2-ECD / humanes ErbB2/Her2 Herstatin
HER2/neu/ErbB-2 (human epidermal growth factor receptor 2) ist ein Membranglycoprotein der ErbB-Familie von Tyrosinkinaserezeptoren. Die Proteine dieser Gruppe (ErbB1-4) dienen als Rezeptoren der Epidermal growth Faktoren. ErbB2 wird auf...
571,73 € *
rHu EpCAM - 100 µg rHu EpCAM - 100 µg
Das Epithelial Cell Adhesion Molekül (EpCAM), auch bekannt als Antigen GA733-2 ist ein 40 kDa Transmembranglycoprotein. Es besteht aus einer 242 aminosäurelangen extrazellulären Domäne (ED), einer 23 aminosäurelangen Transmembranregion...
755,44 € *
Arachis hypogaea Lektin (PNA) Arachis hypogaea Lektin (PNA)
Arachis hypogaea lectin or Peanut Agglutinin (PNA) is isolated from peanuts and purified by affinity chromatography. The lectin has a molecular weight of 110 kDa and consists of four identical subunits of approximately 27 kDa each. PNA...
ab 107,81 € *
Artocarpus integrifolia lectin (Jacalin) Artocarpus integrifolia Lektin (Jacalin)
Artocarpus integrifolia lectin (Jacalin) is isolated from jackfruit seeds and purified by affinity chromatography. The lectin belongs to the family of galactose-binding lectins and has a tetrameric two-chain structure with a weight of 66...
ab 113,48 € *
Calmodulin Calmodulin, lyophilisiert
Calmodulin ist ein bioaktives Protein mit dem Molgewicht 16,7 kDa das aus Rinderhoden isoliert wird. Das Material stammt aus Rindern die in Schweden geboren und heran gezüchtet wurden (Schweden ist ein BSE-freies Land). Calmodulin ist...
ab 113,48 € *
Crotalaria juncea Lektin Crotalaria juncea Lektin
Crotalaria juncea is isolated from the Crotalaria juncea seeds. It is a glycoprotein which displays specificity toward ß-galactosides and specifically interacts with serum glycoproteins, cytochrome b5 and virus surface glycoproteins...
ab 226,96 € *
Lens culinaris Lektin - LCA/LcH Lens culinaris Lektin - LCA/LcH
Lens culinaris lectin or agglutinin (LCA) is isolated from Lens culinaris (lentil) seeds and purified by affinity chromatography. The lectin has two subunits and a molecular weight of 46 kDa and it forms a complex together with sucrose....
ab 97,85 € *
Narcissus pseudonarcissus Lektin Narcissus pseudonarcissus Lektin
Narcissus pseudonarcissus Lektin (NPL) wird aus Narzissen isoliert. Das Protein ist im nativen Zustand ein Homodimer von 26 kDa. Die Untereinheiten haben somit ein MW von 13 kDa. NPL zeigt eine Spezifität gegen alphaverknüpfte Mannose....
ab 226,97 € *
Galanthus nivalis lectin (GNA) - structure Galanthus nivalis Lektin
Galanthus nivalis lectin or agglutinin (GNA) is isolated from snowdrop bulbs. It has a molecular weight of 50 kDa and consists of four identical subunits. The lectin is known to agglutinate rabbit erythrocytes but not human erythrocytes....
ab 106,61 € * 115,00 € *
Phaseolus vulgaris Lektin E - PHA-E Phaseolus vulgaris Lektin E - PHA-E
Phaseolus vulgaris Lectin E (PHA-E) wird aus Red Kidney Bohnen gewonnen und mittels Affinitäts- und Ionenaustauschchromatographie gereinigt. Es ist ein tetrameres Protein mit einem Molekulargewicht von 128kDa. Das Lectin erkennt und...
ab 113,48 € *
Phaseolus vulgaris Lektin P Phaseolus vulgaris Lektin P
Phaseolus vulgaris Lectin P (PHA-P) wird aus Red Kidney Bohnen gewonnen und mittels Affinitäts- und Ionenaustauschchromatographie gereinigt. Das Lectin besteht aus 2 Untereinheiten von PHA-E und PHA-L und stellt somit die Vorstufe von...
ab 109,22 € *
Phaseolus vulgaris Lektin L (PHA-L) Phaseolus vulgaris Lektin L (PHA-L)
Phaseolus vulgaris Lectin L (PHA-L) wird aus Red Kidney Bohnen gewonnen und mittels Affinitätschromatographie gereinigt. Es ist ein tetrameres Protein mit einem Molekulargewicht von 126kDa und 31kDa von jeder Untereinheit. Das Lectin...
ab 79,44 € *
Lektin aus Triticum vulgaris (Weizen) Lektin aus Triticum vulgaris (Weizen)
Lyophilisiertes Pulver von Lektin aus Triticum vulgaris (WGA). WGA ist nicht blutgruppenspezifisch, zeigt aber eine Affinität zu N-acetyl-β-D-glucosaminyl-Resten und N-acetyl-β-D-glucosamin Oligomeren. WGA besitzt keine proteingebundenen...
ab 107,81 € *
Vicia ervilia Lektin - VEA Vicia ervilia Lektin - VEA
Vicia ervilia lectin or agglutinin (VEA) is isolated from bitter vetch seeds and has a molecular weight of 53 kDa. This lectin is blood group non-specific with sugar specificity for α-mannose and, to a lesser extent, α-glucose residues...
ab 211,15 € *
Rinderalbumin acetyliert Rinderalbumin acetyliert
Das acetylierte Albumin wird besonders für alle molekularbiologischen Anwendungen empfohlen. Im Herstellungsprozess werden Essigsäureanhydrid und chaotropische Agenzien eingesetzt, die jegliche Nuklease und Proteaseaktivität zerstören.
ab 140,30 € *
Rinderserumalbumin (BSA) - Fettsäurefrei Rinderserumalbumin (BSA) - Fettsäurefrei
Kristallisiertes Albumin ist ein Albumin Fraktion V, das dreimal bei Temperaturen unter 0°C umkristallisiert wurde. Dadurch enthält man ein sehr natives Protein, das frei von Kohlehydraten, Globulinen und Fettsäuren ist.
ab 101,33 € *
Rinderserumalbumin (BSA) Fraction V (pH 7,0) Rinderserumalbumin (BSA) Fraction V (pH 7,0)
Rinderserumalbumin (BSA) Fraction V (pH 7,0) ist ein lyphilisiertes Albumin der Standardreinheit. Serumalbumin vom Rind (BSA) wird häufig zur Stabilisierung von Proteinen den entsprechenden Puffern zugesetzt. Die Konzentration liegt in...
ab 65,03 € *
Albumin aus Hühnereiweiss - Ovalbumin Albumin aus Hühnereiweiss - Ovalbumin
Albumin aus Hühnereiweiß (Ovalbumin) ist ein phosphoryliertes Glycoprotein das 385 Aminosäurereste enthält und ein Molekulargewicht von 42,7 kDa besitzt. Hühnereiweiß ist der mengenmäßig größte Proteinbestandteil von Eiklar. Wird in der...
ab 215,51 € *
Ovalbumin (Rohextrakt) Ovalbumin (Rohextrakt)
Albumin aus Hühnerei (Ovalbumin). Rohextrakt: mind. 80% Proteingehalt.
ab 59,17 € *
Rinderserumalbumin - Mikrobiologie Grade Rinderserumalbumin - Mikrobiologie Grade
Rinderalbumin mit spezieller Reinheit für die Mikrobiologie. Besonders geeignet für z.B. Mycobacterien, Trypanosomen, Mycoplasmen, etc.. Application and characteristics Typically used for manufacturing and in immunodiagnostic assays such...
ab 56,04 € *
rek. humanes Serumalbumin (rHSA) rek. humanes Serumalbumin (rHSA)
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
ab 270,19 € *
ß-Agarase (EC - 100 units ß-Agarase (EC - 100 units
ß-Agarase wird für die Isolierung reiner DNA und RNA aus niedrig schmelzender Agarose benutzt (Ishumatsu K. et al. (1956) Sci. and Ind. (Japan), 30, 137). Eine ß-Agarase unit löst 500mg einer niedrig schmelzenden Agarose bei 40-42°C...
264,10 € *
Catalase (EC ca. 1800 U/mg - 100 mg Catalase (EC ca. 1800 U/mg - 100 mg
Diese Katalase stammt aus einem gentechnish veränderten Stamm von Aspergillus niger. Das Enzym ist im pH-Bereich von 4,0-8,0 aktiv und hat ihr Optimum bei pH 5,5. Catalase zeigt im Temperaturbereich von 30°C bis 65°C Aktivität, wobei das...
67,93 € *
Catalase (EC ca. 5000 U/mg - 1 g Catalase (EC ca. 5000 U/mg - 1 g
Diese Katalase stammt aus einem gentechnish veränderten Stamm von Aspergillus niger. Das Enzym ist im pH-Bereich von 4,0-8,0 aktiv und hat ihr Optimum bei pH 5,5. Catalase zeigt im Temperaturbereich von 30°C bis 65°C Aktivität, wobei das...
152,90 € *
alpha-Chymotrypsin (EC alpha-Chymotrypsin (EC
alpha-Chymotrypsin ist eine Serinprotease die Peptidbindungen mit aromatischen oder großen hydrophoben Seitenketten (Tyr, Trp, Phe, Leu) am Carboxyende spaltet. Dabei aktiviert und stabilisieren Ca2+ Ionen das Enzym. alpha-Chymotrypsin...
ab 63,88 € *
Lipase (EC Lipase (EC
Lipasen sind Enzyme, die von Lipiden wie Glyceriden oder Cholesterinestern freie Fettsäuren abspalten (Lipolyse). Diese Enzyme spielen physiologisch eine wichtige Rolle, indem sie Fette verdauen und so die im Körper gespeicherten...
ab 96,71 € *
Lysozym from Genaxxon Molbio Grade Lysozym aus Hühnereiweiß, min....
Lysozym hydrolysiert bevorzugt die β-1,4-glykosidische Bindung zwischen N-Acetylmuraminsäure und N-Acetyl-D-glucosamin, Bestandteile der Proteoglycan-Zellwand bestimmter Mikroorganismen, und baut die Heteroglycankette zu Disacchariden...
ab 33,22 € *
Pankreatin Pankreatin
Pankreatin ist ein enzymatisch komplexes Gemisch von Wirkstoffen die aus der Bauchspeicheldrüse von Hausschweinen gewonnen werden.
ab 44,86 € *
Papain Papain
Papain gehört zu den proteolytischen Enzymen, die eine freie Sulfhydryl-Gruppe für die Aktivität brauchen (Gruppe der Cystein-Proteasen). Das pH-Optimum von Papain liegt bei pH6 und das Temperatur-Optimum bei 65°C. Beim isoelektrischen...
34,32 € *
Pepsin from Genaxxon Pepsin (EC
Pepsin aus Schweinemagen. Seine inaktive Vorstufe ist das von den Hauptzellen der Magenschleimhaut sezernierte Pepsinogen. Pepsinogen wird bei einem sauren pH-Wert unter 3 in das proteolytisch wirksame Pepsin gespalten. Pepsin gehört zu...
ab 35,86 € *
TEV Protease TEV Protease - aus Tobacco Etch Virus
TEV-Protease ist eine hochspezifische Cysteinprotease aus dem Tobacco Etch Virus (TEV). Aufgrund ihrer hohen Sequenzabhängigkeit ist die TEV-Protease spezifischer als Faktor Xa, Thrombin oder Enterokinase. Damit ist die TEV-Protease ein...
ab 161,52 € *
Serratia Nuclease - 100000 IU Serratia Nuclease - 100000 IU
Serratia nuclease is a non-specific enzyme that cleaves all forms of DNA and RNA very efficiently. It is commonly used on biological material for the quantitative removal of nucleic acids and for viscosity reduction. The nuclease can be...
589,65 € *
rAminopeptidase rAminopeptidase
Recombinant Aeromonas Aminopeptidase
ab 253,58 € *
Meerrettichperoxidase - HRP Meerrettichperoxidase - HRP
Meerrettichperoxidase (HRP) aus Meerrettichextrakten wird intensiv in der Molekularbiologie, der Antikörperdetektion (ELISA) und weiteren Anwendungen eingesetzt. Meerrettichperoxidase wird sehr häufig bei den folgenden Anwendungen...
79,75 € *
rek. L-Asparaginase rek. L-Asparaginase
L-Asparaginase is an enzyme that depletes L-Asparagine an important nutrient for cancer cells resulting in cancer/tumor cell starvation. L-asparaginase is an anti-tumor agent derived from E.coli., which can inhibit the growth of...
ab 181,30 € *
recombinant Lysostaphin - Glycyl-glycine Endopeptidase recombinantes Lysostaphin - EC
Lysostaphin, eine spezifische Endopeptidase für Zellwandpeptidoglycane von Staphylococci , ist ein extrem potentes anti- Staphylococcus Reagenz. Lysostaphin wird in der Diagnostik und Forschung eingesetzt. Weil es Staphylococci sehr...
ab 170,89 € *
Nona-D-Arginin / D-Arg9 (r9) Nona-D-Arginin / D-Arg9 (r9)
Nona-D-Arginin (r9, bzw. Sequenz: rrrrrrrrr) gehört zur Gruppe der zellpenetrierenden Peptiden (CPPs), die durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie Peptiden,...
ab 279,41 € *
Crystal structure of Ni, Ca Concanavalin A Concanavalin A
Concanavalin A is a member of a group of proteins called lectins which are proteins that react with specific sugar residues. It has broad applicability and is the most widely used lectin within molecular biology research. The...
ab 64,00 € *
Rinderalbumin für EIA und RIA Rinderalbumin für EIA und RIA
IgG-freies Rinderserumalbumin. Besonders als Blockierungs- und Stabilisierungsreagenz in allen Antikörper-vermittelten Nachweissystemen empfohlen. Zusätzlich zur IgG-Freiheit zeigt dieses Albumin auch einen sehr geringen Fettsäuregehalt...
ab 55,25 € *
Trypsin aus Rinderpankreas Trypsin aus Rinderpankreas
Trypsin aus Rinderpankreas, min. 2500 U/mg (nach BAEE) lyophilisiert. Enthält ca. 0.1% Chymotrypsin, Elastase und nichtproteolytische Aktivitäten. Einheiten-Definition: Die Enzymmenge, die einen Anstieg der Absorption bei 253 nm von...
ab 76,20 € *
Chymotrypsinogen A Chymotrypsinogen A
Chymotrypsinogen ist der praktisch inakive "Precursor" (Proenzym, oder auch Zymogen) von Chymotrypsin. Um aktiviert zu werden, muss Chymotrypsinogen zwischen den Aminosäuren Arginin und Isoleucin (R15 und I16) durch Trypsin gespalten...
365,65 € *
Catalase (EC ca. 11000 U/mg Catalase (EC ca. 11000 U/mg
Diese Katalase stammt aus einem gentechnish veränderten Stamm von Aspergillus niger. Das Enzym ist im pH-Bereich von 4,0-8,0 aktiv und hat ihr Optimum bei pH 5,5. Catalase zeigt im Temperaturbereich von 30°C bis 65°C Aktivität, wobei das...
ab 162,48 € *
CPPs, wie CyloP-1, werden im Allgemeinen von endozytotischen Pfaden aufgenommen wobei die vesikuläre Verkapselung sich als limitierender Faktor im Bereich des intrazellulären Targeting darstellt. CyLoP-1, wurde entwickelt, weil es eine...
ab 120,00 € * 150,00 € *
Antennapedia (43-58) penetratin Antennapedia (43-58) penetratin
Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie Peptiden, Proteinen, Nukleinsäuren und Nanopartikeln zu fördern. CPPs sind...
ab 181,02 € * 190,55 € *
D-TAT (47-57) ygrkkrrqrrr-NH2 D-TAT (47-57) ygrkkrrqrrr-NH2
Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie Peptiden, Proteinen, Nukleinsäuren und Nanopartikeln zu fördern. CPPs sind...
ab 279,13 € *
Nona-Arginin - Arg9 (R9) Nona-Arginin - Arg9 (R9)
Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie Peptiden, Proteinen, Nukleinsäuren und Nanopartikeln zu fördern. CPPs sind...
ab 72,25 € * 85,00 € *
Influenza A MP (58-66) HLA-A*02:01 GILGFVFTL Influenza A MP (58-66) HLA-A*02:01 GILGFVFTL
Influenza A MP (58-66) HLA-A*02:01 GILGFVFTL T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der Regel Peptide mit einer Größe zwischen 8 und 11...
ab 72,00 € * 90,00 € *
HIV-1 p17 Gag (77-85) HLA-A*02:01 SLYNTVATL HIV-1 p17 Gag (77-85) HLA-A*02:01 SLYNTVATL
HIV-1 p17 Gag (77-85) - SLYNTVATL gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der Regel Peptide mit einer...
ab 72,00 € * 90,00 € *
HCV NS5B (2594-2602) HLA-A*02:01 ALYDVVTKL HCV NS5B (2594-2602) HLA-A*02:01 ALYDVVTKL
T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der Regel Peptide mit einer Größe zwischen 8 und 11 Aminosäuren und zeigen MHC-spezifische...
ab 72,00 € * 90,00 € *
melan_a_mart_1_26_35_eaagigiltv Melan-A / MART-1 (26-35) - EAAGIGILTV - A*02:01
Melan-A / MART-1 (26-35) - EAAGIGILTV HLA Typ A*02:01 gehört zur Gruppe der T-Zell-Epitop-Peptide. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in...
ab 72,00 € * 90,00 € *
LCVM GP (33-41) peptide sequence LCMV GP (33-41) KAVYNFATM
LCMV GP (33-41) mit der Peptidsequenz KAVYNFATM ist ein T-Zell-Epitop-Peptid, das auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert wird. T-Zell-Epitope sind in der Regel Peptide mit einer Größe...
ab 72,00 € * 90,00 € *
Influenza A NP (366-374) H-2 Db ASNENMETM Influenza A NP (366-374) H-2 Db ASNENMETM
Influenza A NP (366-374) H-2 Db ASNENMETM. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der Regel Peptide mit einer Größe zwischen 8 und 11...
ab 72,00 € * 90,00 € *
MAGE-A3 (271-279) HLA-A*02:01 FLWGPRALV MAGE-A3 (271-279) HLA-A*02:01 FLWGPRALV
MAGE-A3 (271-279) FLWGPRALV Antigen gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der Regel Peptide mit...
ab 85,50 € * 90,00 € *
OVA peptide SIINFEKL Ova (257-264) SIINFEKL
Ova (257-264) - SIINFEKL gehört zu den T-Zell-Epitop-Peptiden.Ovalbumin (257-264) aus Huhn wird benutzt um die T-Zell. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese...
ab 72,00 € * 90,00 € *
Das pan-HLA-DR-bindende Epitop (PADRE - Peptid AKFVAAWTLKAAA) wurde als ein einfaches Epitoppeptid vorgeschlagen, das für die Entwicklung von synthetischen und rekombinanten Impfstoffen geeignet sein könnte. T-Zell-Epitope werden auf der...
ab 164,40 € * 205,50 € *
MBP (1-11) Human - Ac-ASQKRPSQRHG MBP (1-11) Human - Ac-ASQKRPSQRHG
MBP (1-11) Human - Ac-ASQKRPSQRHG repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist...
ab 171,00 € * 185,00 € *
MBP (54-72) Human - SHHAARTTHYGSLPQKSQR repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS)...
ab 251,75 € * 270,00 € *
PLP (139 - 151) - HCLGKWLGHPDKF repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 140,25 € * 165,00 € *
PLP (178-191) - NTWTTCQSIAFPSK repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 144,00 € *
In wissenschaftlichen Experimenten induziert das MOG Peptidfragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) eine autoimmune Encephalomyelitis bei Nagetieren. Eine einzige Injektion mit diesem Peptid löst eine...
ab 166,50 € * 185,00 € *
MOG (91-108) SDEGGYTCFFRDHSYQEE repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 223,25 € * 235,00 € *
MOG (183-191) - FVIVPVLGP MOG (183-191) - FVIVPVLGP
MOG (183-191) FVIVPVLGP repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 72,00 € * 90,00 € *
MOG (97-108) TCFFRDHSYQEE repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 175,75 € * 185,00 € *
MOG (92-106) DEGGYTCFFRDHSYQ repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 148,32 € *
RIIGL - Inhibitorpeptid von Amyloid-beta RIIGL - Inhibitorpeptid von Amyloid-beta
RIIGL is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches....
ab 153,83 € *
Amyloid-beta (16-20) KLVFF Inhibitorpeptid von Amyloid-beta Amyloid-beta (16-20) KLVFF Inhibitorpeptid von...
The KLVFF peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display...
92,70 € *
Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ. Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by...
ab 201,61 € *
DWGKGGRWRLWPGASGKTEA - Inhibitorpeptid von Amyloid-beta DWGKGGRWRLWPGASGKTEA - Inhibitorpeptid von...
DWGKGGRWRLWPGASGKTEA peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by...
ab 201,57 € *
Ac-KLVFF-NH2 is the N-terminal and C-terminal modified form of the amyloid-beta (16-20) inhibitor peptid KLVFF. The modification leads to higher stability against peptidases. The KLVFF peptide is one of several inhibitors of amyloid-beta...
ab 154,08 € *
Growth-hormone-releasing hormone (GHRH) Growth-hormone-releasing hormone (GHRH)
Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or GHRF) or somatocrinin, is a 44-amino acid peptide hormone produced in the arcuate nucleus of the hypothalamus. GHRH is released from...
ab 164,44 € *
Pam3Cys-SKKKK (Biotin-Aca-Aca) Pam3Cys-SKKKK (Biotin-Aca-Aca)
Das synthetische, triacyliertes Pam3Cys-SKKKK > repräsentiert das N-terminale Ende vom bakteriellen Lipoprotein Pam3Cys-AA15. Pam3Cys-SKKKK ist das meist eingesetzte, synthetische Analog zu natürlich vorkommenden Lipoproteinen und oft in...
ab 238,70 € *
1 von 3