Für die Filterung wurden keine Ergebnisse gefunden!
FSL-1 TLR2/TLR6 Agonist FSL-1 (Pam2C-GDPKHPKSF) showed higher activity than MALP-2 when tested for its capability to activate THP-1 cells to produce TNF-alpha and on HEK293 cells transfected with TLR2 and TLR6 to produce NF-kappaB (Okusawa et al. 2004). It was...
495,71 € *
FSL-1 FLAG-tag TLR2/TLR6 Agonist FSL-1 (Pam2CysGDPKHPKSF) showed higher activity than MALP-2 when tested for its capability to activate THP-1 cells to produce TNF-alpha and on HEK293 cells transfected with TLR2 and TLR6 to produce NF-kappaB (Okusawa et al. 2004). It was...
ab 250,64 € *
Lipopeptid Pam-Dhc-GDPKHPKSF Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
345,32 € *
Lipopeptid Pam-Dhc-SKKKK Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
228,35 € *
Lipopeptid GDPKHPKSF Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK > , Pam2Cys-SKKKK > or FSL-1 > are analogues or substructures of TLR2 ligands...
314,44 € *
Lipopeptid PamCSKKKK Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
228,35 € *
Lipopeptide PamCGDPKHPKSF Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
373,17 € *
Lipopeptid Dhc-SKKKK Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
206,08 € *
Lipopeptid Dhc-GDPKHPKSF Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
314,44 € *
Lipopeptid SKKKK Monoacylated lipopeptides, peptides with the unusual amino acid dihydroxypropylcystein (Dhc), or peptides representing the peptide moieties of Pam3Cys-SKKKK, Pam2Cys-SKKKK or FSL-1 are analogues or substructures of TLR2 ligands and...
217,22 € *
Pam3CysSSNAKIDQLSSDVQT The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
506,85 € *
Pam3CysSSNKSTTGSGETTTA The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
506,85 € *
Pam3CysSSTKPVSQDTSPKPA The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
506,85 € *
Pam3CysSSGSKPSGGPLPDAK The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
506,85 € *
Pam3CysSSGNKSAPSSSASSS The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
506,85 € *
Pam3CysGSHQMKSEGHANMQL The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
506,85 € *
Pam3CysSSSNNDAAGNGAAQT The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
506,85 € *
Pam3CysKQNVSSLDEKNSVSV The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
506,85 € *
Pam3CysNNSGKDGNTSANSAD The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
506,85 € *
Pam3CysNNGGPELKSDEVAKS The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
506,85 € *
Pam3CysSQEPAAPAAEATPAG The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
506,85 € *
Pam3CysSSSKSSDSSAPKAYG The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
501,28 € *
Pam3CysAQEKEAKSELDYDQT The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
517,99 € *
Pam2Cys-SKKKK Toll-like receptors 2/6 heterodimers are activated by diacylated lipoproteins and their synthetic lipopeptide analogues. All offered diacylated lipopeptides are based on L-cysteine and are provided as lyophilised powders without any...
ab 161,52 € *
PHC-SKKKK Toll-like receptors 2/6 heterodimers are activated by diacylated lipoproteins and their synthetic lipopeptide analogues. All offered diacylated lipopeptides are based on L-cysteine and are provided as lyophilised powders without any...
228,35 € *
Amyloid-beta (1-40) Ratte [beta]-Amyloid (1-40), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are...
ab 264,97 € *
Amyloid-beta (1-40) Ratte (HCl Salz) [beta]-Amyloid (1-40), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are...
ab 406,21 € *
Amyloid-beta (1-40). human... [beta]-Amyloid (1-40), human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques...
ab 245,74 € *
Amyloid-beta (1-40) human (HCl Salz)... [beta]-Amyloid (1-40), human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques...
ab 406,21 € *
Kontrollpeptid Amyloid-beta (40-1) Ratte Kontrollpeptid Amyloid-beta (40-1) von Ratte. Charakteristisch für die Alzheimer-Krankheit ist die Anreicherung von Amyloid-Plaques im Gehirn. Die Hauptkomponenten dieser Plaques sind Amyloid-ß-Peptide mit 39-42 Aminosäuren, die durch...
ab 245,74 € *
Kontrollpeptid Amyloid-beta (40-1) human Kontrollpeptid Amyloid-beta (40-1). Charakteristisch für die Alzheimer-Krankheit ist die Anreicherung von Amyloid-Plaques im Gehirn. Die Hauptkomponenten dieser Plaques sind Amyloid-ß-Peptide mit 39-42 Aminosäuren, die durch...
ab 245,74 € *
Biotinyliertes Amyloid-beta (1-40) Ratte Biotinyliertes Amyloid-ß (1-40) Peptid. Biotinylierte Peptide sind ein nützliches Werkzeug für viele wichtige Anwendungen in der Alzheimerforschung. Biotin hat eine starke Affinität zu Avidin oder Streptavidin. Diese Wechselwirkung kann...
ab 480,82 € *
Biotinyliertes Amyloid-beta (1-40) human Biotinyliertes Amyloid-ß (1-40) Peptid. Biotinylierte Peptide sind ein nützliches Werkzeug für viele wichtige Anwendungen in der Alzheimerforschung. Biotin hat eine starke Affinität zu Avidin oder Streptavidin. Diese Wechselwirkung kann...
ab 480,82 € *
qshyrhispaqv (D-Aminosäuren) Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
ab 201,61 € *
FYLKVPSSLHHHHGRDKLVFFHHHH Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
ab 201,61 € *
Peptid: NYSKMIFSHHHH Das Peptid: NYSKMIFSHHHH ist einer von verschiedenen publizierten Inhibitoren der amyloid-beta Aggregation. Viele dieser Inhibitoren sind Fragmente und/oder modifizierte Peptide der nativen amyloid-beta Sequenz. Andere wiederum wurden...
ab 154,08 € *
Amyloid inhibitor peptide - HNHKLVFFHHQH Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
ab 154,08 € *
Protein L-Ligand Leakage Elisa Kit This Protein L-Ligand Leakage Elisa kit has been designed to detect and quantify Protein L in Immunoglobulin (Ig) or Ig-fragment containing solutions. It is a sandwich ELISA with microtiter strips coated with an affinity purified...
1.222,60 € *
Protein L-Ligand Leakage Elisa XL The Protein L-Ligand Leakage ELISA-kit has been designed to detect and quantify Protein L in Immunoglobulin (Ig) or Ig-fragment containing solutions. It is a sandwich ELISA with microtiter strips coated with an affinity purified...
1.387,34 € *
Trypsin aus Schweinepankreas (1:250) Trypsin 1:250 aus Schweinepankreas (240 - 260 USP U/mg). Enthält Chymotrypsin, Elastase und nichtproteolytische Aktivitäten. Die native Form von Trypsin besteht aus einem einkettigen Polypeptid von 223 Aminosäureresten, das durch...
ab 119,32 € *
Collagenase Typ I (EC 3.4.24.3) >100 units/mg Collagenase aus Clostridium histolyticum ist ein Enzymgemisch aus Collagenase, Clostripain sowie tryptischen und proteolytischen Aktivitäten. Collagenase Typ I zeigt eine ausgeglichene Aktivität von Collagenase, Clostripain sowie...
ab 77,61 € * 110,87 € *
Collagenase Typ II (EC 3.4.24.3) >180 units/mg Collagenase aus Clostridium histolyticum ist ein Enzymgemisch aus Collagenase, Clostripain sowie tryptischen und proteolytischen Aktivitäten. Collagenase Typ II weißt eine hohe Clostripain-Aktivität auf. Die tryptische Aktivität...
ab 77,61 € * 110,87 € *
Collagenase Typ III (EC 3.4.24.3) Collagenase aus Clostridium histolyticum ist ein Enzymgemisch aus Collagenase, Clostripain sowie tryptischen und proteolytischen Aktivitäten. Collagenase Typ III zeigt eine geringe proteolytische bei gleichzeit normaler...
ab 183,75 € *
Collagenase Typ IV (EC 3.4.24.3) >900 units/mg Collagenase aus Clostridium histolyticum ist ein Enzymgemisch aus Collagenase, Clostripain sowie tryptischen und proteolytischen Aktivitäten. Collagenase Typ IV weißt eine geringe tryptische, hohe Collagenase- und normale...
ab 77,61 € * 110,87 € *
hGHRP-2 / Human Growth Hormone Releasing Peptide-2 Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs to stimulate GH release. GHRP-2, an investigational drug, is one of the most potent...
ab 132,61 € *
rhuPTH - rekombinantes humanes... Parathyroid hormone (PTH), or parathormone, is secreted by the parathyroid glands as a polypeptide of 84 amino acids. It acts to increase the concentration of calciumin in the blood, whereas calcitonin (a hormone produced by the...
ab 300,50 € *
rHu Vitronectin Vitronectin is a multifunctional glycoprotein present in blood and in the extra-cellular matrix. The complete open reading frame encodes for 459 amino acids which are preceded by a 19 amino acid signal peptide. It contains three...
ab 294,79 € *
rHu HER2-ECD / humanes ErbB2/Her2 Herstatin HER2/neu/ErbB-2 (human epidermal growth factor receptor 2) ist ein Membranglycoprotein der ErbB-Familie von Tyrosinkinaserezeptoren. Die Proteine dieser Gruppe (ErbB1-4) dienen als Rezeptoren der Epidermal growth Faktoren. ErbB2 wird auf...
600,32 € *
rHu EpCAM - 100 µg Das Epithelial Cell Adhesion Molekül (EpCAM), auch bekannt als Antigen GA733-2 ist ein 40 kDa Transmembranglycoprotein. Es besteht aus einer 242 aminosäurelangen extrazellulären Domäne (ED), einer 23 aminosäurelangen Transmembranregion...
793,21 € *
Arachis hypogaea Lektin (PNA) Arachis hypogaea lectin or Peanut Agglutinin (PNA) is isolated from peanuts and purified by affinity chromatography. The lectin has a molecular weight of 110 kDa and consists of four identical subunits of approximately 27 kDa each. PNA...
ab 113,20 € *
Artocarpus integrifolia Lektin (Jacalin) Artocarpus integrifolia lectin (Jacalin) is isolated from jackfruit seeds and purified by affinity chromatography. The lectin belongs to the family of galactose-binding lectins and has a tetrameric two-chain structure with a weight of 66...
ab 119,15 € *
Calmodulin, lyophilisiert Calmodulin ist ein bioaktives Protein mit dem Molgewicht 16,7 kDa das aus Rinderhoden isoliert wird. Das Material stammt aus Rindern die in Schweden geboren und heran gezüchtet wurden (Schweden ist ein BSE-freies Land). Calmodulin ist...
ab 119,15 € *
Crotalaria juncea Lektin Crotalaria juncea is isolated from the Crotalaria juncea seeds. It is a glycoprotein which displays specificity toward ß-galactosides and specifically interacts with serum glycoproteins, cytochrome b5 and virus surface glycoproteins...
ab 238,31 € *
Lens culinaris Lektin - LCA/LcH Lens culinaris lectin or agglutinin (LCA) is isolated from Lens culinaris (lentil) seeds and purified by affinity chromatography. The lectin has two subunits and a molecular weight of 46 kDa and it forms a complex together with sucrose....
ab 102,74 € *
Narcissus pseudonarcissus Lektin Narcissus pseudonarcissus Lektin (NPL) wird aus Narzissen isoliert. Das Protein ist im nativen Zustand ein Homodimer von 26 kDa. Die Untereinheiten haben somit ein MW von 13 kDa. NPL zeigt eine Spezifität gegen alphaverknüpfte Mannose....
ab 238,32 € *
Galanthus nivalis Lektin Galanthus nivalis lectin or agglutinin (GNA) is isolated from snowdrop bulbs. It has a molecular weight of 50 kDa and consists of four identical subunits. The lectin is known to agglutinate rabbit erythrocytes but not human erythrocytes....
ab 111,94 € * 124,37 € *
Phaseolus vulgaris Lektin E - PHA-E Phaseolus vulgaris Lectin E (PHA-E) wird aus Red Kidney Bohnen gewonnen und mittels Affinitäts- und Ionenaustauschchromatographie gereinigt. Es ist ein tetrameres Protein mit einem Molekulargewicht von 128kDa. Das Lectin erkennt und...
ab 119,15 € *
Phaseolus vulgaris Lektin P Phaseolus vulgaris Lectin P (PHA-P) wird aus Red Kidney Bohnen gewonnen und mittels Affinitäts- und Ionenaustauschchromatographie gereinigt. Das Lectin besteht aus 2 Untereinheiten von PHA-E und PHA-L und stellt somit die Vorstufe von...
ab 114,68 € *
Phaseolus vulgaris Lektin L (PHA-L) Phaseolus vulgaris Lectin L (PHA-L) wird aus Red Kidney Bohnen gewonnen und mittels Affinitätschromatographie gereinigt. Es ist ein tetrameres Protein mit einem Molekulargewicht von 126kDa und 31kDa von jeder Untereinheit. Das Lectin...
ab 83,41 € *
Lektin aus Triticum vulgaris (Weizen) Lyophilisiertes Pulver von Lektin aus Triticum vulgaris (WGA). WGA ist nicht blutgruppenspezifisch, zeigt aber eine Affinität zu N-acetyl-β-D-glucosaminyl-Resten und N-acetyl-β-D-glucosamin Oligomeren. WGA besitzt keine proteingebundenen...
ab 113,20 € *
Vicia ervilia Lektin - VEA Vicia ervilia lectin or agglutinin (VEA) is isolated from bitter vetch seeds and has a molecular weight of 53 kDa. This lectin is blood group non-specific with sugar specificity for α-mannose and, to a lesser extent, α-glucose residues...
ab 221,71 € *
Rinderalbumin acetyliert Das acetylierte Albumin wird besonders für alle molekularbiologischen Anwendungen empfohlen. Im Herstellungsprozess werden Essigsäureanhydrid und chaotropische Agenzien eingesetzt, die jegliche Nuklease und Proteaseaktivität zerstören.
ab 147,32 € *
Rinderserumalbumin (BSA) - Fettsäurefrei Kristallisiertes Albumin ist ein Albumin Fraktion V, das dreimal bei Temperaturen unter 0°C umkristallisiert wurde. Dadurch enthält man ein sehr natives Protein, das frei von Kohlehydraten, Globulinen und Fettsäuren ist.
ab 106,40 € *
Rinderserumalbumin (BSA) Fraction V (pH 7,0) Rinderserumalbumin (BSA) Fraction V (pH 7,0) ist ein lyphilisiertes Albumin der Standardreinheit. Serumalbumin vom Rind (BSA) wird häufig zur Stabilisierung von Proteinen den entsprechenden Puffern zugesetzt. Die Konzentration liegt in...
ab 68,28 € *
Albumin aus Hühnereiweiss - Ovalbumin Albumin aus Hühnereiweiß (Ovalbumin) ist ein phosphoryliertes Glycoprotein das 385 Aminosäurereste enthält und ein Molekulargewicht von 42,7 kDa besitzt. Hühnereiweiß ist der mengenmäßig größte Proteinbestandteil von Eiklar. Wird in der...
ab 226,29 € *
Ovalbumin (Rohextrakt) Albumin aus Hühnerei (Ovalbumin). Rohextrakt: mind. 80% Proteingehalt.
ab 75,00 € *
Rinderserumalbumin - Mikrobiologie Grade Rinderalbumin mit spezieller Reinheit für die Mikrobiologie. Besonders geeignet für z.B. Mycobacterien, Trypanosomen, Mycoplasmen, etc.. Application and characteristics Typically used for manufacturing and in immunodiagnostic assays such...
ab 58,84 € *
rek. humanes Serumalbumin (rHSA) Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
ab 283,70 € *
ß-Agarase (EC 3.2.1.81) - 100 units ß-Agarase wird für die Isolierung reiner DNA und RNA aus niedrig schmelzender Agarose benutzt (Ishumatsu K. et al. (1956) Sci. and Ind. (Japan), 30, 137). Eine ß-Agarase unit löst 500mg einer niedrig schmelzenden Agarose bei 40-42°C...
277,31 € *
Catalase (EC 1.11.1.6). ca. 1800 U/mg - 100 mg Diese Katalase stammt aus einem gentechnish veränderten Stamm von Aspergillus niger. Das Enzym ist im pH-Bereich von 4,0-8,0 aktiv und hat ihr Optimum bei pH 5,5. Catalase zeigt im Temperaturbereich von 30°C bis 65°C Aktivität, wobei das...
71,33 € *
Catalase (EC 1.11.1.6). ca. 5000 U/mg - 1 g Diese Katalase stammt aus einem gentechnish veränderten Stamm von Aspergillus niger. Das Enzym ist im pH-Bereich von 4,0-8,0 aktiv und hat ihr Optimum bei pH 5,5. Catalase zeigt im Temperaturbereich von 30°C bis 65°C Aktivität, wobei das...
160,55 € *
alpha-Chymotrypsin (EC 3.4.21.1) alpha-Chymotrypsin ist eine Serinprotease die Peptidbindungen mit aromatischen oder großen hydrophoben Seitenketten (Tyr, Trp, Phe, Leu) am Carboxyende spaltet. Dabei aktiviert und stabilisieren Ca2+ Ionen das Enzym. alpha-Chymotrypsin...
ab 67,07 € *
Lipase (EC 3.1.1.3) Lipasen sind Enzyme, die von Lipiden wie Glyceriden oder Cholesterinestern freie Fettsäuren abspalten (Lipolyse). Diese Enzyme spielen physiologisch eine wichtige Rolle, indem sie Fette verdauen und so die im Körper gespeicherten...
ab 101,55 € *
Molbio Grade Lysozym aus Hühnereiweiß, min.... Lysozym hydrolysiert bevorzugt die β-1,4-glykosidische Bindung zwischen N-Acetylmuraminsäure und N-Acetyl-D-glucosamin, Bestandteile der Proteoglycan-Zellwand bestimmter Mikroorganismen, und baut die Heteroglycankette zu Disacchariden...
ab 34,88 € *
Pankreatin Pankreatin ist ein enzymatisch komplexes Gemisch von Wirkstoffen die aus der Bauchspeicheldrüse von Hausschweinen gewonnen werden.
ab 47,10 € *
Papain Papain gehört zu den proteolytischen Enzymen, die eine freie Sulfhydryl-Gruppe für die Aktivität brauchen (Gruppe der Cystein-Proteasen). Das pH-Optimum von Papain liegt bei pH6 und das Temperatur-Optimum bei 65°C. Beim isoelektrischen...
63,15 € *
Pepsin (EC 3.4.23.1) Pepsin aus Schweinemagen. Seine inaktive Vorstufe ist das von den Hauptzellen der Magenschleimhaut sezernierte Pepsinogen. Pepsinogen wird bei einem sauren pH-Wert unter 3 in das proteolytisch wirksame Pepsin gespalten. Pepsin gehört zu...
ab 37,65 € *
TEV Protease - aus Tobacco Etch Virus TEV-Protease ist eine hochspezifische Cysteinprotease aus dem Tobacco Etch Virus (TEV). Aufgrund ihrer hohen Sequenzabhängigkeit ist die TEV-Protease spezifischer als Faktor Xa, Thrombin oder Enterokinase. Damit ist die TEV-Protease ein...
ab 169,60 € *
Serratia Nuclease - 100000 IU Serratia nuclease is a non-specific enzyme that cleaves all forms of DNA and RNA very efficiently. It is commonly used on biological material for the quantitative removal of nucleic acids and for viscosity reduction. The nuclease can be...
619,13 € *
Meerrettichperoxidase - HRP Meerrettichperoxidase (HRP) aus Meerrettichextrakten wird intensiv in der Molekularbiologie, der Antikörperdetektion (ELISA) und weiteren Anwendungen eingesetzt. Meerrettichperoxidase wird sehr häufig bei den folgenden Anwendungen...
83,74 € *
rek. L-Asparaginase L-Asparaginase is an enzyme that depletes L-Asparagine an important nutrient for cancer cells resulting in cancer/tumor cell starvation. L-asparaginase is an anti-tumor agent derived from E.coli., which can inhibit the growth of...
ab 190,37 € *
recombinantes Lysostaphin - EC 3.4.24.75 Lysostaphin, eine spezifische Endopeptidase für Zellwandpeptidoglycane von Staphylococci , ist ein extrem potentes anti- Staphylococcus Reagenz. Lysostaphin wird in der Diagnostik und Forschung eingesetzt. Weil es Staphylococci sehr...
ab 170,89 € *
Nona-D-Arginin / D-Arg9 (r9) Nona-D-Arginin (r9, bzw. Sequenz: rrrrrrrrr) gehört zur Gruppe der zellpenetrierenden Peptiden (CPPs), die durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie Peptiden,...
ab 279,41 € *
Concanavalin A Concanavalin A is a member of a group of proteins called lectins which are proteins that react with specific sugar residues. It has broad applicability and is the most widely used lectin within molecular biology research. The...
ab 67,20 € *
Rinderalbumin für EIA und RIA IgG-freies Rinderserumalbumin. Besonders als Blockierungs- und Stabilisierungsreagenz in allen Antikörper-vermittelten Nachweissystemen empfohlen. Zusätzlich zur IgG-Freiheit zeigt dieses Albumin auch einen sehr geringen Fettsäuregehalt...
ab 58,01 € *
Trypsin aus Rinderpankreas Trypsin aus Rinderpankreas, min. 2500 U/mg (nach BAEE) lyophilisiert. Enthält ca. 0.1% Chymotrypsin, Elastase und nichtproteolytische Aktivitäten. Einheiten-Definition: Die Enzymmenge, die einen Anstieg der Absorption bei 253 nm von...
331,02 € *
Chymotrypsinogen A Chymotrypsinogen ist der praktisch inakive "Precursor" (Proenzym, oder auch Zymogen) von Chymotrypsin. Um aktiviert zu werden, muss Chymotrypsinogen zwischen den Aminosäuren Arginin und Isoleucin (R15 und I16) durch Trypsin gespalten...
383,93 € *
Catalase (EC 1.11.1.6). ca. 11000 U/mg Diese Katalase stammt aus einem gentechnish veränderten Stamm von Aspergillus niger. Das Enzym ist im pH-Bereich von 4,0-8,0 aktiv und hat ihr Optimum bei pH 5,5. Catalase zeigt im Temperaturbereich von 30°C bis 65°C Aktivität, wobei das...
ab 170,60 € *
CyLoP-1 Peptid CRWRWKCCKK CPPs, wie CyloP-1, werden im Allgemeinen von endozytotischen Pfaden aufgenommen wobei die vesikuläre Verkapselung sich als limitierender Faktor im Bereich des intrazellulären Targeting darstellt. CyLoP-1, wurde entwickelt, weil es eine...
ab 200,00 € * 250,00 € *
Antennapedia (43-58) penetratin Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie Peptiden, Proteinen, Nukleinsäuren und Nanopartikeln zu fördern. CPPs sind...
ab 190,07 € * 190,55 € *
D-TAT (47-57) ygrkkrrqrrr-NH2 Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie Peptiden, Proteinen, Nukleinsäuren und Nanopartikeln zu fördern. CPPs sind...
ab 279,13 € *
PLP (139-151) HCLGKWLGHPDKF PLP (139 - 151) - HCLGKWLGHPDKF repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 148,00 € * 185,00 € *
PLP (178-191) NTWTTCQSIAFPSK PLP (178-191) - NTWTTCQSIAFPSK repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 148,00 € * 185,00 € *
MOG (35-55) Human MEVGWYRPPFSRVVHLYRNGK In wissenschaftlichen Experimenten induziert das MOG Peptidfragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) eine autoimmune Encephalomyelitis bei Nagetieren. Eine einzige Injektion mit diesem Peptid löst eine...
ab 168,00 € * 210,00 € *
MOG (97-108) TCFFRDHSYQEE MOG (97-108) TCFFRDHSYQEE repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele der Immunabwehr bei Multipler Sklerose. Multiple Sklerose (MS) ist eine...
ab 168,00 € * 210,00 € *
RIIGL - Inhibitorpeptid von Amyloid-beta RIIGL is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches....
ab 153,83 € *
Amyloid-beta (16-20) KLVFF Inhibitorpeptid von... The KLVFF peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display...
97,34 € *
Amyloid-beta Peptid PGRSPFTGKKLFNQEFSQDQ Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ. Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by...
ab 211,69 € *
DWGKGGRWRLWPGASGKTEA - Inhibitorpeptid von... DWGKGGRWRLWPGASGKTEA peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by...
ab 211,65 € *
Ac-KLVFF-NH2 Ac-KLVFF-NH2 is the N-terminal and C-terminal modified form of the amyloid-beta (16-20) inhibitor peptid KLVFF. The modification leads to higher stability against peptidases. The KLVFF peptide is one of several inhibitors of amyloid-beta...
ab 154,08 € *
Growth-hormone-releasing hormone (GHRH) Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or GHRF) or somatocrinin, is a 44-amino acid peptide hormone produced in the arcuate nucleus of the hypothalamus. GHRH is released from...
ab 164,44 € *
Pam3Cys-SKKKK (Biotin-Aca-Aca) Das synthetische, triacyliertes Pam3Cys-SKKKK > repräsentiert das N-terminale Ende vom bakteriellen Lipoprotein Pam3Cys-AA15. Pam3Cys-SKKKK ist das meist eingesetzte, synthetische Analog zu natürlich vorkommenden Lipoproteinen und oft in...
ab 250,64 € *
R-Pam3Cys-SKKKK Pam3Cys-SKKKK is the mostly used synthetic analogue of naturally occurring lipoproteins and often described in literature as reference compound for TLR2/1 activation. Pam3Cys-SKKKK is provided as stereochemically defined compound and as...
ab 250,64 € *
Pam3Cys-SKKKK (Fluorescein-Aca-Aca) Pam3Cys-SKKKK is the mostly used synthetic analogue of naturally occurring lipoproteins and often described in literature as reference compound for TLR2/1 activation. Pam3Cys-SKKKK is provided as stereochemically defined compound and as...
ab 250,64 € *
S-Pam3Cys-SKKKK Pam3Cys-SKKKK is the mostly used synthetic analogue of naturally occurring lipoproteins and often described in literature as reference compound for TLR2/1 activation. Pam3Cys-SKKKK is provided as stereochemically defined compound and as...
ab 250,64 € *
Pam3Cys-SKKKK (Rhodamin-Aca-Aca) Triacyl-Lipopeptid. The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins...
ab 250,64 € *
Pam3Cys-SKKKK-FLAG-tag The synthetic, triacylated lipopeptides represent the N-terminal lipohexadecapeptides, Pam3Cys-AA15, of bacterial lipoproteins. Names of lipoproteins and origin are indicated. For a complete list of all lipoproteins see attachement....
ab 250,64 € *
Lipobiotin - PHC-KKKKK(Biotin-Aca-Aca) Lipobiotin - PHC-KKKKK(Biotin-Aca-Aca) is a selectively biotinylated analogue of PHC-SKKKK ( P2232 > ). Biotin is attached via spacer molecules to the side chain of the C-terminal lysine. The Biotin-avidin or -streptavidin interaction...
ab 272,92 € *
R-Pam2Cys-SKKKK Toll-like receptors 2/6 heterodimers are activated by diacylated lipoproteins and their synthetic lipopeptide analogues. All offered diacylated lipopeptides are based on L-cysteine and are provided as lyophilised powders without any...
ab 250,64 € *
S-Pam2Cys-SKKKK Toll-like receptors 2/6 heterodimers are activated by diacylated lipoproteins and their synthetic lipopeptide analogues. All offered diacylated lipopeptides are based on L-cysteine and are provided as lyophilised powders without any...
ab 250,64 € *
Pam2Cys-SKKKK(Rhodamine-Aca-Aca)-NH2 Toll-like receptors 2/6 heterodimers are activated by diacylated lipoproteins and their synthetic lipopeptide analogues. All offered diacylated lipopeptides are based on L-cysteine and are provided as lyophilised powders without any...
ab 250,64 € *
Pam2Cys-SKKKK-FLAG-tag Toll-like receptors 2/6 heterodimers are activated by diacylated lipoproteins and their synthetic lipopeptide analogues. All offered diacylated lipopeptides are based on L-cysteine and are provided as lyophilised powders without any...
ab 250,64 € *
FSL-1 (Pam2CysGDPKHPKSF) - R.S-stereoisomer FSL-1 (Pam2CysGDPKHPKSF) showed higher activity than MALP-2 when tested for its capability to activate THP-1 cells to produce TNF-alpha and on HEK293 cells transfected with TLR2 and TLR6 to produce NF-kappaB (Okusawa et al. 2004). It was...
ab 250,64 € *
FSL-1 (Pam2CysGDPKHPKSF) - R-stereoisomer FSL-1 (Pam2CysGDPKHPKSF) showed higher activity than MALP-2 when tested for its capability to activate THP-1 cells to produce TNF-alpha and on HEK293 cells transfected with TLR2 and TLR6 to produce NF-kappaB (Okusawa et al. 2004). It was...
ab 250,64 € *
FSL-1-Biotin TLR2/TLR6 Agonist FSL-1 (Pam2CysGDPKHPKSF) showed higher activity than MALP-2 when tested for its capability to activate THP-1 cells to produce TNF-alpha and on HEK293 cells transfected with TLR2 and TLR6 to produce NF-kappaB (Okusawa et al. 2004). It was...
ab 250,64 € *
FSL-1-Fluorescein TLR2/TLR6 Agonist FSL-1 (Pam2CysGDPKHPKSF) showed higher activity than MALP-2 when tested for its capability to activate THP-1 cells to produce TNF-alpha and on HEK293 cells transfected with TLR2 and TLR6 to produce NF-kappaB (Okusawa et al. 2004). It was...
ab 250,64 € *
FSL-1-Rhodamin TLR2/TLR6 Agonist FSL-1 (Pam2CysGDPKHPKSF) showed higher activity than MALP-2 when tested for its capability to activate THP-1 cells to produce TNF-alpha and on HEK293 cells transfected with TLR2 and TLR6 to produce NF-kappaB (Okusawa et al. 2004). It was...
ab 250,64 € *
MALP-2-DI (Pam2CysGNNDESNISFKEKDI) -... FSL-1 (Pam2CysGDPKHPKSF) showed higher activity than MALP-2 when tested for its capability to activate THP-1 cells to produce TNF-alpha and on HEK293 cells transfected with TLR2 and TLR6 to produce NF-kappaB (Okusawa et al. 2004). It was...
401,02 € *
MALP-2-DI (Pam2CysGNNDESNISFKEKDI) -... FSL-1 (Pam2CysGDPKHPKSF) showed higher activity than MALP-2 when tested for its capability to activate THP-1 cells to produce TNF-alpha and on HEK293 cells transfected with TLR2 and TLR6 to produce NF-kappaB (Okusawa et al. 2004). It was...
501,28 € *
Ovalbumin CMV pp65 MOG 35-55 Ratte Melan-A MART-1 Variante Collagenase Typ Pam2Cys-SKKKK SARS-CoV-2 rek. HPV 16 E7 49-57 SARS-CoV-2 Ova 257-264 SARS-CoV-2 humanes LL-37 SARS-CoV-2 Variant SARS-CoV-2 HIV-1 TAT 47-57 Trypsin aus rHu HER2-ECD humanes FSH - Collagenase Typ SARS-CoV-2 Collagenase Typ Nona-Arginin - human ACE2 Lysozym aus Variante PADRE - CMV IE-1 99-107