Peptide & Proteine

Genaxxon bioscience liefert Peptide als Lagerware (Lipopeptide, MHC-Peptide, MS-Peptide, Alzheimer-Peptide) oder synthetisiert Peptide auf Kundenwunsch seit 2002. Als eine DIN ISO 9001-2015 zertifizierte Firma bieten wir unseren Kunden höchste Qualität bei unseren Peptiden, wie: isotopenmarkierte Peptide, immunogene Peptide, Peptide mit posttranslationalen Modifikationen, Peptide mit Fluoreszenzlabel, Biotin oder auch anderen Modifikationen.

Für unsere Kunden, die auf Gebieten wie Alzheimer´s Disease, Multiple Sklerose oder immunogenen Defekten arbeiten, bieten wir Peptide als Lagerware höchster Qualität an. Siehe: "Cell Penetrating Peptide", MHC-I und MCH-II PeptidePeptide für die Alzheimerforschung oder Multiple Sklerose.

Zusätzlich erhalten Sie von Genaxxon eine breite Palette von Lipopeptiden, die als Teil der äußeren Membran von Gram-negativen und Gram-positiven Bakterien und Mykoplasmen vorkommen und als Zellaktivierungssignale über so genannte "toll like receptors" agieren.

Genaxxon bioscience liefert Peptide als Lagerware (Lipopeptide, MHC-Peptide, MS-Peptide, Alzheimer-Peptide) oder synthetisiert Peptide auf Kundenwunsch seit 2002. Als eine DIN ISO... mehr erfahren »
Fenster schließen
Peptide & Proteine

Genaxxon bioscience liefert Peptide als Lagerware (Lipopeptide, MHC-Peptide, MS-Peptide, Alzheimer-Peptide) oder synthetisiert Peptide auf Kundenwunsch seit 2002. Als eine DIN ISO 9001-2015 zertifizierte Firma bieten wir unseren Kunden höchste Qualität bei unseren Peptiden, wie: isotopenmarkierte Peptide, immunogene Peptide, Peptide mit posttranslationalen Modifikationen, Peptide mit Fluoreszenzlabel, Biotin oder auch anderen Modifikationen.

Für unsere Kunden, die auf Gebieten wie Alzheimer´s Disease, Multiple Sklerose oder immunogenen Defekten arbeiten, bieten wir Peptide als Lagerware höchster Qualität an. Siehe: "Cell Penetrating Peptide", MHC-I und MCH-II PeptidePeptide für die Alzheimerforschung oder Multiple Sklerose.

Zusätzlich erhalten Sie von Genaxxon eine breite Palette von Lipopeptiden, die als Teil der äußeren Membran von Gram-negativen und Gram-positiven Bakterien und Mykoplasmen vorkommen und als Zellaktivierungssignale über so genannte "toll like receptors" agieren.

Filter schließen
 
  •  
  •  
von bis
1 von 20
Für die Filterung wurden keine Ergebnisse gefunden!
[beta]-Amyloid (10-20) - YEVHHQKLVFF
[beta]-Amyloid (10-20) - YEVHHQKLVFF
[beta]-Amyloid (10-20) (peptide sequence: YEVHHQKLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-42 peptide. Amyloid-beta (1-42) human is an Alzheimer desease peptide. Characteristic of Alzheimer...
195,00 € *
[beta]-Amyloid (16-20) - KLVFF
[beta]-Amyloid (16-20) - KLVFF
[beta]-Amyloid (16-20) (peptide sequence: KLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-40 peptide. Biotinylated amyloid-ß-peptides: Biotinylated peptides are a useful tool in many important...
ab 145,23 € *
human growth hormon releasing factor 6
[D-Lys3]-GHRP-6
[D-Lys3]-GHRP6 (growth hormone releasing peptide 6) induces the secretion of growth hormone (GH). In the membrane of clonal GC somatotropes, this peptide elevates the number of functional voltage-gated Ca2+ and Na+ channels. Chronic...
ab 95,00 € *
3x FLAG Peptid - DYKDDDDK-DYKDDDDK-MDYKDDDDK
3x FLAG Peptid - DYKDDDDK-DYKDDDDK-MDYKDDDDK
Das DYKDDDDK-Peptid (Peptidsequenz: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, inklusive einer Enterokinase-Schnittstelle) wurde speziell für die Immunaffinitätschromatographie entwickelt. Das Peptid erlaubt die kompetitive Elution von Proteinen...
375,00 € *
Ac-KLVFF-NH2
Ac-KLVFF-NH2
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
ab 145,23 € *
Accutase® Cell Detachment Solution - 100 mL
Accutase® Cell Detachment Solution - 100 mL
Gegenüber dem gebräuchlichen Trypsin zeigt Accutase(R) ein weitaus schonenderes Ablöseprofil. Da die Grundsubstanz von Accutase® weder aus Wirbeltier- noch Bakterienmaterial gewonnen wird, sind entsprechende Viruskontaminationen oder...
65,04 € *
Albumin from egg - Ovalbumin
Albumin from egg - Ovalbumin
Albumin aus Hühnereiweiß (Ovalbumin). Wird in der Proteinforschung zur Molmassenmessung und der Strukturaufklärung verwendet. Es dient auch als Vergleichsstandard in diesen Bereichen.
ab 203,14 € *
alpha-Chymotrypsin (EC 3.4.21.1), grade I
alpha-Chymotrypsin (EC 3.4.21.1), grade I
alpha-Chymotrypsin ist eine Serinprotease die Peptidbindungen mit aromatischen oder großen hydrophoben Seitenketten (Tyr, Trp, Phe, Leu) am Carboxyende spaltet. Dabei aktiviert und stabilisieren Ca2+ Ionen das Enzym. alpha-Chymotrypsin...
ab 60,21 € *
Amyloid-beta (1-40) human - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Amyloid-beta (1-40) human -...
Amyloid-beta (1-40) human is an Alzheimer desease peptide. Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which...
ab 220,60 € *
Amyloid-beta (1-40) human (HCl Salz)
Amyloid-beta (1-40) human (HCl Salz)
Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly....
ab 364,66 € *
Amyloid-beta (1-40) Ratte
Amyloid-beta (1-40) Ratte
Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly....
ab 220,60 € *
Amyloid-beta (1-40) Ratte (HCl Salz)
Amyloid-beta (1-40) Ratte (HCl Salz)
Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly....
ab 364,66 € *
1 von 20