Variante Omicron B.1.1.529 BA.5 Peptid Pool SARS-CoV-2 full length (Spike Glycoprotein)

Variante Omicron B.1.1.529 BA.5 Peptid Pool SARS-CoV-2 full length (Spike Glycoprotein)


Artikel-Nr.: P2784.0315

Shipping: shipped at RT, store at -20°C

Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

802,50 € *
Dieser Peptidpool der Omicron-Variante B.1.1.529 BA.5 von SARS-CoV-2 (315 Peptide, aufgeteilt in... mehr
Produktinformationen "Variante Omicron B.1.1.529 BA.5 Peptid Pool SARS-CoV-2 full length (Spike Glycoprotein)"

Dieser Peptidpool der Omicron-Variante B.1.1.529 BA.5 von SARS-CoV-2 (315 Peptide, aufgeteilt in zwei Subpools von 158 und 157 Peptiden) umfasst das gesamte Spike-Glykoprotein mit allen Mutationen.

Mögliche Anwendungen: T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response.

Jedes Peptid ist mittels Festphasenextraktion gereinigt und durch ESI-MS auf die Reinheit kontrolliert.
Die Peptide dieses Produkts werden lyophilisiert als Trifluoracetat-Salze geliefert.

Peptide Scan 15/11
Länge: 1270 Aminosäuren

MFVFLVLLPLVSSQCVNLITRTQSPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHVIHGTNGTKRFDNPVLPFNDGVYFASIEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKV
CEFQFCNDPFLDVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPIIGRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWT
AGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFDEVFNATKFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKL
NDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLRSYGFRPTYGVGHQPYRVVVLSF
ELLHAPATVCGPKKSTNLVKNKCVNFNFNGLKGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVF
QTRAGCLIGAEYVNNSYECDIPIGAGICASYQTQTKSHRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLKRALTGIA
VEQDKNTQEVFAQVKQIYKTPPIKYFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFA
MQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNHNAQALNTLVKQLSSKFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAAT
KMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKY
FKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

 

Weitere Artikel passend zu "Variante Omicron B.1.1.529 BA.5 Peptid Pool SARS-CoV-2 full length (Spike Glycoprotein)"
Specifications: Pool of 315 peptides Purity: Each peptide ESI-MS checked, pool is purified by... mehr
 

Technische Daten:

Specifications:
Pool of 315 peptides
Purity: Each peptide ESI-MS checked, pool is purified by solid phase extraction.
Sequences: see separate document
Amount: 15 nmol (approx. 25ug)/peptide for stimulation of 2,5 x 10E8 cells (7875µg for complete pool)
Counter ion: TFA
UniProt ID: P0DTC2

Lyophilized white powder

Applikation:

For T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr


Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu Variante Omicron B.1.1.529 BA.5 Peptid Pool SARS-CoV-2 full length (Spike Glycoprotein). Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.