Bioaktive Proteine

Endotheliales Rindermitogen (ECGS) - Calmodulin - Natürliches Mauslaminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin

Endotheliales Rindermitogen (ECGS) - Calmodulin - Natürliches Mauslaminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin mehr erfahren »
Fenster schließen
Bioaktive Proteine

Endotheliales Rindermitogen (ECGS) - Calmodulin - Natürliches Mauslaminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin

Filter schließen
von bis
1 von 2
Für die Filterung wurden keine Ergebnisse gefunden!
Das DYKDDDDK-Peptid (Peptidsequenz: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, inklusive einer Enterokinase-Schnittstelle) wurde speziell für die Immunaffinitätschromatographie entwickelt. Das Peptid erlaubt die kompetitive Elution von Proteinen...
ab 283,77 € * 290,00 € *
Albumin from egg - Ovalbumin
Albumin from egg - Ovalbumin
Albumin aus Hühnereiweiß (Ovalbumin). Wird in der Proteinforschung zur Molmassenmessung und der Strukturaufklärung verwendet. Es dient auch als Vergleichsstandard in diesen Bereichen.
ab 215,51 € *
Calmodulin, lyophilisiert
Calmodulin ist ein bioaktives Protein mit dem Molgewicht 16,7 kDa das aus Rinderhoden isoliert wird. Das Material stammt aus Rindern die in Schweden geboren und heran gezüchtet wurden (Schweden ist ein BSE-freies Land). Calmodulin ist...
ab 113,48 € *
Dermcidin - DCD-1...
Dermcidin-1 (DCD-1) besteht aus 4 Aminosäuren und ist ein antibakterielles Peptid (AMP). Dermcidin wird in Schweißdrüsen exprimiert und in den Schweiß, in einer Konzentration von 1-10µg/mL, sezerniert und zur Hautoberfläche...
ab 387,23 € *
Dermcidin - DCD-1L...
Dermcidin-1L (DCD-1L) besteht aus 48 Aminosäuren und ist ein antibakterielles Peptid (AMP) mit einem Leucin am C-Terminus. Dermcidin wird in Schweißdrüsen exprimiert und in den Schweiß, in einer Konzentration von 1-10µg/mL, sezerniert...
ab 387,23 € *
Endotheliales Rindermitogen (ECGS)
Endotheliales Rindermitogen (ECGS)
Endothelial Mitogen can be used for Human & Mammalian Vascular Endothelial Cells at concentration of 0.1-0.3mg/mL of serum supplemented media & 0.01-0.1mg with heparin (Some primary cells require supplementation of 1-100µg/mL heparin)....
ab 191,28 € *
Das DYKDDDDK-Peptid (Peptidsequenz: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, inklusive einer Enterokinase-Schnittstelle) wurde speziell für die Immunaffinitätschromatographie entwickelt. Das Peptid erlaubt die kompetitive Elution von Proteinen...
ab 118,75 € * 125,00 € *
humanes LL-37...
LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
ab 285,00 € * 300,00 € *
humanes LL-37...
LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
ab 196,27 € *
Das MDYKDHDG-DYKDHDI-DYKDDDDK, ein synthetisches Peptid, wurde speziell für die Immunaffinitätschromatographie entwickelt. Das Peptid erlaubt die kompetitive Elution von Proteinen unter milden, nicht-denaturierenden Bedingungen. Das...
397,84 € *
Ovalbumin (Rohextrakt)
Ovalbumin (Rohextrakt)
Albumin aus Hühnerei (Ovalbumin). Rohextrakt: mind. 80% Proteingehalt.
ab 59,17 € *
rek. humanes Serumalbumin (rHSA)
rek. humanes Serumalbumin (rHSA)
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
ab 270,19 € *
1 von 2