Bioaktive Proteine

Endotheliales Rindermitogen (ECGS) - Calmodulin - Natürliches Mauslaminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin

Endotheliales Rindermitogen (ECGS) - Calmodulin - Natürliches Mauslaminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin mehr erfahren »
Fenster schließen
Bioaktive Proteine

Endotheliales Rindermitogen (ECGS) - Calmodulin - Natürliches Mauslaminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin

Filter schließen
von bis
Für die Filterung wurden keine Ergebnisse gefunden!
Calmodulin Calmodulin, lyophilisiert
Calmodulin ist ein bioaktives Protein mit dem Molgewicht 16,7 kDa das aus Rinderhoden isoliert wird. Das Material stammt aus Rindern die in Schweden geboren und heran gezüchtet wurden (Schweden ist ein BSE-freies Land). Calmodulin ist...
ab 113,48 € *
Endotheliales Rindermitogen (ECGS) Endotheliales Rindermitogen (ECGS)
Endothelial Mitogen can be used for Human & Mammalian Vascular Endothelial Cells at concentration of 0.1-0.3mg/mL of serum supplemented media & 0.01-0.1mg with heparin (Some primary cells require supplementation of 1-100µg/mL heparin)....
ab 191,28 € *
Rinderalbumin acetyliert Rinderalbumin acetyliert
Das acetylierte Albumin wird besonders für alle molekularbiologischen Anwendungen empfohlen. Im Herstellungsprozess werden Essigsäureanhydrid und chaotropische Agenzien eingesetzt, die jegliche Nuklease und Proteaseaktivität zerstören.
ab 140,30 € *
Rinderserumalbumin (BSA) - Fettsäurefrei Rinderserumalbumin (BSA) - Fettsäurefrei
Kristallisiertes Albumin ist ein Albumin Fraktion V, das dreimal bei Temperaturen unter 0°C umkristallisiert wurde. Dadurch enthält man ein sehr natives Protein, das frei von Kohlehydraten, Globulinen und Fettsäuren ist.
ab 101,33 € *
Rinderalbumin für EIA und RIA Rinderalbumin für EIA und RIA
Kompatibel mit vielen diagnostischen Enzymen und Komponenten. Hauptsächlich monomeres Albumin. IgGs nicht detektierbar.
ab 67,54 € *
Rinderserumalbumin (BSA) Fraction V (pH 7,0) Rinderserumalbumin (BSA) Fraction V (pH 7,0)
Rinderserumalbumin (BSA) Fraction V (pH 7,0) ist ein lyphilisiertes Albumin der Standardreinheit. Serumalbumin vom Rind (BSA) wird häufig zur Stabilisierung von Proteinen den entsprechenden Puffern zugesetzt. Die Konzentration liegt in...
ab 65,03 € *
Albumin aus Hühnereiweiss - Ovalbumin Albumin aus Hühnereiweiss - Ovalbumin
Albumin aus Hühnereiweiß (Ovalbumin) ist ein phosphoryliertes Glycoprotein das 385 Aminosäurereste enthält und ein Molekulargewicht von 42,7 kDa besitzt. Hühnereiweiß ist der mengenmäßig größte Proteinbestandteil von Eiklar. Wird in der...
ab 215,51 € *
Ovalbumin (Rohextrakt) Ovalbumin (Rohextrakt)
Albumin aus Hühnerei (Ovalbumin). Rohextrakt: mind. 80% Proteingehalt.
ab 59,17 € *
Rinderserumalbumin - Mikrobiologie Grade Rinderserumalbumin - Mikrobiologie Grade
Rinderalbumin mit spezieller Reinheit für die Mikrobiologie. Besonders geeignet für z.B. Mycobacterien, Trypanosomen, Mycoplasmen, etc.. Application and characteristics Typically used for manufacturing and in immunodiagnostic assays such...
ab 56,04 € *
rek. humanes Serumalbumin (rHSA) rek. humanes Serumalbumin (rHSA)
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
ab 270,19 € *
Das MDYKDHDG-DYKDHDI-DYKDDDDK, ein synthetisches Peptid, wurde speziell für die Immunaffinitätschromatographie entwickelt. Das Peptid erlaubt die kompetitive Elution von Proteinen unter milden, nicht-denaturierenden Bedingungen. Das...
397,84 € *
Dermcidin-1L (DCD-1L) besteht aus 48 Aminosäuren und ist ein antibakterielles Peptid (AMP) mit einem Leucin am C-Terminus. Dermcidin wird in Schweißdrüsen exprimiert und in den Schweiß, in einer Konzentration von 1-10µg/mL, sezerniert...
ab 387,23 € *
Dermcidin-1 (DCD-1) besteht aus 4 Aminosäuren und ist ein antibakterielles Peptid (AMP). Dermcidin wird in Schweißdrüsen exprimiert und in den Schweiß, in einer Konzentration von 1-10µg/mL, sezerniert und zur Hautoberfläche...
ab 387,23 € *
Das DYKDDDDK-Peptid (Peptidsequenz: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, inklusive einer Enterokinase-Schnittstelle) wurde speziell für die Immunaffinitätschromatographie entwickelt. Das Peptid erlaubt die kompetitive Elution von Proteinen...
ab 143,20 € * 160,00 € *
humanes LL-37 - scrambled - GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR humanes LL-37 - scrambled -...
LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
ab 174,25 € * 205,00 € *
Rinderalbumin (BSA), sehr niedriges Endotoxin Rinderalbumin (BSA), sehr niedriges Endotoxin
Hitzebehandeltes Albumin (entsprechend 10 Stunden bei 60°C). IgG nicht nachweisbar. Frei von Mycoplasma und Rinderviren. Frei von Caprylsäure und von anderen Stabilisatoren die für Zelllinien toxisch wirken könnten. Auf die Verwendung in...
ab 77,25 € *
Das DYKDDDDK-Peptid (Peptidsequenz: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, inklusive einer Enterokinase-Schnittstelle) wurde speziell für die Immunaffinitätschromatographie entwickelt. Das Peptid erlaubt die kompetitive Elution von Proteinen...
ab 135,00 € *
LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
ab 174,25 € * 205,00 € *