Bioaktive Proteine

Endotheliales Rindermitogen (ECGS) - Calmodulin - Natürliches Mauslaminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin

Endotheliales Rindermitogen (ECGS) - Calmodulin - Natürliches Mauslaminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin mehr erfahren »
Fenster schließen
Bioaktive Proteine

Endotheliales Rindermitogen (ECGS) - Calmodulin - Natürliches Mauslaminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin

Filter schließen
von bis
Für die Filterung wurden keine Ergebnisse gefunden!
Calmodulin Calmodulin, lyophilisiert
Calmodulin ist ein bioaktives Protein mit dem Molgewicht 16,7 kDa das aus Rinderhoden isoliert wird. Das Material stammt aus Rindern die in Schweden geboren und heran gezüchtet wurden (Schweden ist ein BSE-freies Land). Calmodulin ist...
ab 122,72 € *
Rinderalbumin acetyliert Rinderalbumin acetyliert
Das acetylierte Albumin wird besonders für alle molekularbiologischen Anwendungen empfohlen. Im Herstellungsprozess werden Essigsäureanhydrid und chaotropische Agenzien eingesetzt, die jegliche Nuklease und Proteaseaktivität zerstören.
ab 151,74 € *
Rinderserumalbumin (BSA) - Fettsäurefrei Rinderserumalbumin (BSA) - Fettsäurefrei
Kristallisiertes Albumin ist ein Albumin Fraktion V, das dreimal bei Temperaturen unter 0°C umkristallisiert wurde. Dadurch enthält man ein sehr natives Protein, das frei von Kohlehydraten, Globulinen und Fettsäuren ist.
ab 109,59 € *
Rinderserumalbumin (BSA) Fraction V (pH 7,0) Rinderserumalbumin (BSA) Fraction V (pH 7,0)
Rinderserumalbumin (BSA) Fraction V (pH 7,0) ist ein lyphilisiertes Albumin der Standardreinheit. Serumalbumin vom Rind (BSA) wird häufig zur Stabilisierung von Proteinen den entsprechenden Puffern zugesetzt. Die Konzentration liegt in...
ab 71,00 € *
Albumin aus Hühnereiweiss - Ovalbumin Albumin aus Hühnereiweiss - Ovalbumin
Albumin aus Hühnereiweiß (Ovalbumin) ist ein phosphoryliertes Glycoprotein das 385 Aminosäurereste enthält und ein Molekulargewicht von 42,7 kDa besitzt. Hühnereiweiß ist der mengenmäßig größte Proteinbestandteil von Eiklar. Wird in der...
ab 226,29 € *
Ovalbumin (Rohextrakt) Ovalbumin (Rohextrakt)
Albumin aus Hühnerei (Ovalbumin). Rohextrakt: mind. 80% Proteingehalt.
ab 77,25 € *
rek. humanes Serumalbumin (rHSA) - Lipidfrei rek. humanes Serumalbumin (rHSA) - Lipidfrei
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
ab 242,05 € *
Rinderalbumin für EIA und RIA Rinderalbumin für EIA und RIA
IgG-freies Rinderserumalbumin. Besonders als Blockierungs- und Stabilisierungsreagenz in allen Antikörper-vermittelten Nachweissystemen empfohlen. Zusätzlich zur IgG-Freiheit zeigt dieses Albumin auch einen sehr geringen Fettsäuregehalt...
ab 59,75 € *
Dermcidin-1L (DCD-1L) besteht aus 48 Aminosäuren und ist ein antibakterielles Peptid (AMP) mit einem Leucin am C-Terminus. Dermcidin wird in Schweißdrüsen exprimiert und in den Schweiß, in einer Konzentration von 1-10µg/mL, sezerniert...
ab 925,00 € *
Dermcidin-1 (DCD-1) besteht aus 47 Aminosäuren und ist ein antibakterielles Peptid (AMP). Dermcidin wird in Schweißdrüsen exprimiert und in den Schweiß, in einer Konzentration von 1-10µg/mL, sezerniert und zur Hautoberfläche...
ab 850,00 € *
humanes LL-37 - scrambled - GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR humanes LL-37 - scrambled -...
LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
ab 241,40 € * 284,00 € *
Rinderalbumin (BSA), sehr niedriges Endotoxin Rinderalbumin (BSA), sehr niedriges Endotoxin
Hitzebehandeltes Albumin (entsprechend 10 Stunden bei 60°C). IgG nicht nachweisbar. Frei von Mycoplasma und Rinderviren. Frei von Caprylsäure und von anderen Stabilisatoren die für Zelllinien toxisch wirken könnten. Auf die Verwendung in...
ab 83,54 € *
Das DYKDDDDK-Peptid (Peptidsequenz: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, inklusive einer Enterokinase-Schnittstelle) wurde speziell für die Immunaffinitätschromatographie entwickelt. Das Peptid erlaubt die kompetitive Elution von Proteinen...
ab 140,00 € * 175,00 € *
Das DYKDDDDK-Peptid (Peptidsequenz: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, inklusive einer Enterokinase-Schnittstelle) wurde speziell für die Immunaffinitätschromatographie entwickelt. Das Peptid erlaubt die kompetitive Elution von Proteinen...
ab 238,96 € * 298,70 € *
LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
ab 245,14 € * 306,43 € *
rek. humanes Serumalbumin (rHSA) rek. humanes Serumalbumin (rHSA)
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
ab 566,50 € *
rek. humanes Serumalbumin (rHSA) - aus Pflanzen rek. humanes Serumalbumin (rHSA) - aus Pflanzen
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
ab 509,85 € *