
Genaxxon bioscience hat eine breite Palette an gut charakterisierten rekombinanten und natürlichen Hormonen, die als hochreines, lyophilisiertes Pulver angeboten werden. Unter anderem können Sie von Genaxxon bioscience die folgenden Peptide beziehen: ACTH - Antide - Argipressin - Atosiban - Buserelin - Cetrorelix - DDAVP - Deslorelin - Elcatonin - Exenatide - Ganirelix - GHRL - GHRP-6 - Glucagon - Goserelin - Hexarelin - rHuFSH - hGHRH - hGHRP-2 - hGLP-1 - Histrelin - hLeuprolide - hLHRH - hMG - hPTH - hTSH - HuTRH - Lanreotide - Lypressin - MT-II - NAF - OCT - OT - PMSG - Pramlintide - rExendin-4 - rhCG - rhLHRH - rHuAGRP - hFSH - rHuGLP-1 - rHuGlucagon - rHuIAPP - rHuOXM - rHuProcalcitonin - rHuProguanylin - rHuProuroguanylin - rHuPTH (AS 1-34) - rHuPTH (AS 1-84) - rHuPTH (AS 7-34) - rHuSTC-1 - rHuSTC-2 - rHuThyrostimulin-A - rHuThyrostimulin-B - rHuTSH - sCT - Secretin - Sincalide - SST - Ta1 - Tb4 - Terlipressin - TP-5 - Trp - Vasopressin

Genaxxon bioscience hat eine breite Palette an gut charakterisierten rekombinanten und natürlichen Hormonen, die als hochreines, lyophilisiertes Pulver angeboten werden. Unter anderem können Sie... mehr erfahren »
Fenster schließen

Genaxxon bioscience hat eine breite Palette an gut charakterisierten rekombinanten und natürlichen Hormonen, die als hochreines, lyophilisiertes Pulver angeboten werden. Unter anderem können Sie von Genaxxon bioscience die folgenden Peptide beziehen: ACTH - Antide - Argipressin - Atosiban - Buserelin - Cetrorelix - DDAVP - Deslorelin - Elcatonin - Exenatide - Ganirelix - GHRL - GHRP-6 - Glucagon - Goserelin - Hexarelin - rHuFSH - hGHRH - hGHRP-2 - hGLP-1 - Histrelin - hLeuprolide - hLHRH - hMG - hPTH - hTSH - HuTRH - Lanreotide - Lypressin - MT-II - NAF - OCT - OT - PMSG - Pramlintide - rExendin-4 - rhCG - rhLHRH - rHuAGRP - hFSH - rHuGLP-1 - rHuGlucagon - rHuIAPP - rHuOXM - rHuProcalcitonin - rHuProguanylin - rHuProuroguanylin - rHuPTH (AS 1-34) - rHuPTH (AS 1-84) - rHuPTH (AS 7-34) - rHuSTC-1 - rHuSTC-2 - rHuThyrostimulin-A - rHuThyrostimulin-B - rHuTSH - sCT - Secretin - Sincalide - SST - Ta1 - Tb4 - Terlipressin - TP-5 - Trp - Vasopressin

Filter schließen
von bis
1 von 2
Für die Filterung wurden keine Ergebnisse gefunden!
[Des-octanoyl]-Ghrelin. human...
Ghrelin für engl. "Growth Hormone Release Inducing" ist ein appetitanregendes Hormon, welches in der Magenschleimhaut und der Bauchspeicheldrüse produziert wird. Neben der Appetitanregung hat das Hormon eine Reihe anderer Wirkungen....
ab 318,25 € * 335,00 € *
[Des-octanoyl]-Ghrelin. rat...
Ghrelin für engl. "Growth Hormone Release Inducing" ist ein appetitanregendes Hormon, welches in der Magenschleimhaut und der Bauchspeicheldrüse produziert wird. Neben der Appetitanregung hat das Hormon eine Reihe anderer Wirkungen....
ab 318,25 € * 335,00 € *
[Glu10]-ACTH (1-17). human SYSMEHFRWEKPVGKKR
[Glu10]-ACTH (1-17). human SYSMEHFRWEKPVGKKR
[Glu10]-ACTH (1-17), human SYSMEHFRW E KPVGKKR ist ein synthetisches Peptid entsprechend den ersten 17 Aminosäuren des humanen ACTH/Adrenocorticotropin, wobei allerdings das normalerweise an Position 10 befindliche Glycin gegen...
238,00 € *
Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR ist ein synthetisches Peptid entsprechend den ersten 17 Aminosäuren des humanen ACTH/Adrenocorticotropin. Der N-terminus des Peptids ist acetyliert um eine höhere Stabilität gegen eine mögliche...
238,00 € *
ACTH (1-10). human SYSMEHFRWG
ACTH (1-10). human SYSMEHFRWG
ACTH (1-10), human SYSMEHFRWG ist ein synthetisches Peptid entsprechend den ersten 10 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde. Insbesondere stimuliert...
ab 85,50 € * 90,00 € *
ACTH (1-16), human SYSMEHFRWGKPVGKK ist ein synthetisches Peptid entsprechend den ersten 16 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde. Insbesondere...
238,00 € *
ACTH (1-39). human...
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ist ein synthetisches Peptid entsprechend den ersten 39 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die...
ab 441,75 € * 465,00 € *
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF ist ein synthetisches Peptid entsprechend den Aminosäuren 18 bis 39 des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde....
ab 261,25 € * 275,00 € *
ACTH (4-10). human MEHFRWG
ACTH (4-10). human MEHFRWG
ACTH (4-10), human MEHFRWG ist ein synthetisches Peptid entsprechend den Aminosäuren 4 bis 10 des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde. Insbesondere stimuliert es...
ab 85,50 € * 90,00 € *
Antide Acetate
Antide Acetate
Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s body to represses FSH and LH releases that stem from the pituitary gland. Synthetic versions of this chemical have been developed for...
ab 172,66 € *
human growth hormon releasing factor 6
GHRP6 (growth hormone releasing peptide 6) induces the secretion of growth hormone (GH). In the membrane of clonal GC somatotropes, this peptide elevates the number of functional voltage-gated Ca2+ and Na+ channels. Chronic treatment...
ab 115,88 € * 125,00 € *
Growth-hormone-releasing hormone (GHRH)
Growth-hormone-releasing hormone (GHRH)
Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or GHRF) or somatocrinin, is a 44-amino acid peptide hormone produced in the arcuate nucleus of the hypothalamus. GHRH is released from...
ab 164,44 € *
1 von 2