Hormone

Genaxxon bioscience hat eine breite Palette an gut charakterisierten rekombinanten und natürlichen Hormonen, die als hochreines, lyophilisiertes Pulver angeboten werden. Unter anderem können Sie von Genaxxon bioscience die folgenden Peptide beziehen: ACTH - Antide - Argipressin - Atosiban - Buserelin - Cetrorelix - DDAVP - Deslorelin - Elcatonin - Exenatide - Ganirelix - GHRL - GHRP-6 - Glucagon - Goserelin - Hexarelin - rHuFSH - hGHRH - hGHRP-2 - hGLP-1 - Histrelin - hLeuprolide - hLHRH - hMG - hPTH - hTSH - HuTRH - Lanreotide - Lypressin - MT-II - NAF - OCT - OT - PMSG - Pramlintide - rExendin-4 - rhCG - rhLHRH - rHuAGRP - hFSH - rHuGLP-1 - rHuGlucagon - rHuIAPP - rHuOXM - rHuProcalcitonin - rHuProguanylin - rHuProuroguanylin - rHuPTH (AS 1-34) - rHuPTH (AS 1-84) - rHuPTH (AS 7-34) - rHuSTC-1 - rHuSTC-2 - rHuThyrostimulin-A - rHuThyrostimulin-B - rHuTSH - sCT - Secretin - Sincalide - SST - Ta1 - Tb4 - Terlipressin - TP-5 - Trp - Vasopressin

Genaxxon bioscience hat eine breite Palette an gut charakterisierten rekombinanten und natürlichen Hormonen, die als hochreines, lyophilisiertes Pulver angeboten werden. Unter anderem können Sie... mehr erfahren »
Fenster schließen
Hormone

Genaxxon bioscience hat eine breite Palette an gut charakterisierten rekombinanten und natürlichen Hormonen, die als hochreines, lyophilisiertes Pulver angeboten werden. Unter anderem können Sie von Genaxxon bioscience die folgenden Peptide beziehen: ACTH - Antide - Argipressin - Atosiban - Buserelin - Cetrorelix - DDAVP - Deslorelin - Elcatonin - Exenatide - Ganirelix - GHRL - GHRP-6 - Glucagon - Goserelin - Hexarelin - rHuFSH - hGHRH - hGHRP-2 - hGLP-1 - Histrelin - hLeuprolide - hLHRH - hMG - hPTH - hTSH - HuTRH - Lanreotide - Lypressin - MT-II - NAF - OCT - OT - PMSG - Pramlintide - rExendin-4 - rhCG - rhLHRH - rHuAGRP - hFSH - rHuGLP-1 - rHuGlucagon - rHuIAPP - rHuOXM - rHuProcalcitonin - rHuProguanylin - rHuProuroguanylin - rHuPTH (AS 1-34) - rHuPTH (AS 1-84) - rHuPTH (AS 7-34) - rHuSTC-1 - rHuSTC-2 - rHuThyrostimulin-A - rHuThyrostimulin-B - rHuTSH - sCT - Secretin - Sincalide - SST - Ta1 - Tb4 - Terlipressin - TP-5 - Trp - Vasopressin

Filter schließen
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
von bis
 
Für die Filterung wurden keine Ergebnisse gefunden!
hGHRP-2 / Human Growth Hormone Releasing Peptide-2 hGHRP-2 / Human Growth Hormone Releasing Peptide-2
Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs to stimulate GH release. GHRP-2, an investigational drug, is one of the most potent...
ab 136,59 € *
rhuPTH - rekombinantes humanes Parathyroidhormon (aa 1-34) rhuPTH - rekombinantes humanes...
Parathyroid hormone (PTH), or parathormone, is secreted by the parathyroid glands as a polypeptide of 84 amino acids. It acts to increase the concentration of calciumin in the blood, whereas calcitonin (a hormone produced by the...
ab 309,52 € *
Growth-hormone-releasing hormone (GHRH) Growth-hormone-releasing hormone (GHRH)
Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or GHRF) or somatocrinin, is a 44-amino acid peptide hormone produced in the arcuate nucleus of the hypothalamus. GHRH is released from...
ab 169,37 € *
Antide Acetate Antide Acetate
Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s body to represses FSH and LH releases that stem from the pituitary gland. Synthetic versions of this chemical have been developed for...
ab 186,73 € *
human growth hormon releasing factor 6 GHRP-6 HwAWfK-NH2
GHRP6 (growth hormone releasing peptide 6) induces the secretion of growth hormone (GH). In the membrane of clonal GC somatotropes, this peptide elevates the number of functional voltage-gated Ca2+ and Na+ channels. Chronic treatment...
ab 119,36 € * 132,61 € *
rhCG - Corticotropin releasing hormone binding protein rhCG - Corticotropin releasing hormone binding...
CRH is a powerful stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. CRH concentration in the human peripheral circulation is usually low. The concentration rises during pregnancy and fall back quickly after...
ab 136,59 € *
ACTH (1-10). human SYSMEHFRWG ACTH (1-10). human SYSMEHFRWG
ACTH (1-10), human SYSMEHFRWG ist ein synthetisches Peptid entsprechend den ersten 10 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde. Insbesondere stimuliert...
ab 72,00 € * 90,00 € *
ACTH (1-39). human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39). human...
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ist ein synthetisches Peptid entsprechend den ersten 39 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die...
ab 441,75 € * 465,00 € *
ACTH (18-39). human RPVKVYPNGAEDESAEAFPLEF ACTH (18-39). human RPVKVYPNGAEDESAEAFPLEF
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF ist ein synthetisches Peptid entsprechend den Aminosäuren 18 bis 39 des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde....
ab 261,25 € * 275,00 € *
ACTH (4-10). human MEHFRWG ACTH (4-10). human MEHFRWG
ACTH (4-10), human MEHFRWG ist ein synthetisches Peptid entsprechend den Aminosäuren 4 bis 10 des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde. Insbesondere stimuliert es...
ab 85,50 € * 90,00 € *
[Des-octanoyl]-Ghrelin. human GSSFLSPEHQRVQQRKESKKPPAKLQPR [Des-octanoyl]-Ghrelin. human...
Ghrelin für engl. "Growth Hormone Release Inducing" ist ein appetitanregendes Hormon, welches in der Magenschleimhaut und der Bauchspeicheldrüse produziert wird. Neben der Appetitanregung hat das Hormon eine Reihe anderer Wirkungen....
ab 318,25 € * 335,00 € *
[Des-octanoyl]-Ghrelin. rat GSSFLSPEHQKAQQRKESKKPPAKLQPR [Des-octanoyl]-Ghrelin. rat...
Ghrelin für engl. "Growth Hormone Release Inducing" ist ein appetitanregendes Hormon, welches in der Magenschleimhaut und der Bauchspeicheldrüse produziert wird. Neben der Appetitanregung hat das Hormon eine Reihe anderer Wirkungen....
ab 318,25 € * 335,00 € *
ACTH (1-16). human SYSMEHFRWGKPVGKK ACTH (1-16). human SYSMEHFRWGKPVGKK
ACTH (1-16), human SYSMEHFRWGKPVGKK ist ein synthetisches Peptid entsprechend den ersten 16 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde. Insbesondere...
238,00 € *
Ac-ACTH (1-17). human Ac-SYSMEHFRWGKPVGKKR Ac-ACTH (1-17). human Ac-SYSMEHFRWGKPVGKKR
Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR ist ein synthetisches Peptid entsprechend den ersten 17 Aminosäuren des humanen ACTH/Adrenocorticotropin. Der N-terminus des Peptids ist acetyliert um eine höhere Stabilität gegen eine mögliche...
238,00 € *
[Glu10]-ACTH (1-17). human SYSMEHFRWEKPVGKKR [Glu10]-ACTH (1-17). human SYSMEHFRWEKPVGKKR
[Glu10]-ACTH (1-17), human SYSMEHFRW E KPVGKKR ist ein synthetisches Peptid entsprechend den ersten 17 Aminosäuren des humanen ACTH/Adrenocorticotropin, wobei allerdings das normalerweise an Position 10 befindliche Glycin gegen...
238,00 € *
humanes FSH - Follikel stimulierendes Hormon humanes FSH - Follikel stimulierendes Hormon
Humanes FSH (Follikel stimulierendes Hormon) ist ein Hormon, das von den Gonadotropen in der vorderen Hypophyse synthetisiert und ausgeschieden wird. FSH und LH wirken bei Frauen in der fortpflanzungsfähigen Phase synergistisch zusammen....
ab 149,35 € *
LH - Luteinisierendes Hormon aus Schwein LH - Luteinisierendes Hormon aus Schwein
LH (Luteinisierendes Hormon) aus Schwein ist ein Hormon das die Follikelreifung stimuliert, den Eisprung induziert, sowie die Bildung von Corpus luteum und die Sekretion von Pregnanolon beschleunigt. Das Schweine-Luteinisierungshormon...
ab 118,45 € *