
Genaxxon bioscience hat eine breite Palette an gut charakterisierten rekombinanten und natürlichen Hormonen, die als hochreines, lyophilisiertes Pulver angeboten werden. Unter anderem können Sie von Genaxxon bioscience die folgenden Peptide beziehen: ACTH - Antide - Argipressin - Atosiban - Buserelin - Cetrorelix - DDAVP - Deslorelin - Elcatonin - Exenatide - Ganirelix - GHRL - GHRP-6 - Glucagon - Goserelin - Hexarelin - rHuFSH - hGHRH - hGHRP-2 - hGLP-1 - Histrelin - hLeuprolide - hLHRH - hMG - hPTH - hTSH - HuTRH - Lanreotide - Lypressin - MT-II - NAF - OCT - OT - PMSG - Pramlintide - rExendin-4 - rhCG - rhLHRH - rHuAGRP - hFSH - rHuGLP-1 - rHuGlucagon - rHuIAPP - rHuOXM - rHuProcalcitonin - rHuProguanylin - rHuProuroguanylin - rHuPTH (AS 1-34) - rHuPTH (AS 1-84) - rHuPTH (AS 7-34) - rHuSTC-1 - rHuSTC-2 - rHuThyrostimulin-A - rHuThyrostimulin-B - rHuTSH - sCT - Secretin - Sincalide - SST - Ta1 - Tb4 - Terlipressin - TP-5 - Trp - Vasopressin

Genaxxon bioscience hat eine breite Palette an gut charakterisierten rekombinanten und natürlichen Hormonen, die als hochreines, lyophilisiertes Pulver angeboten werden. Unter anderem können Sie... mehr erfahren »
Fenster schließen

Genaxxon bioscience hat eine breite Palette an gut charakterisierten rekombinanten und natürlichen Hormonen, die als hochreines, lyophilisiertes Pulver angeboten werden. Unter anderem können Sie von Genaxxon bioscience die folgenden Peptide beziehen: ACTH - Antide - Argipressin - Atosiban - Buserelin - Cetrorelix - DDAVP - Deslorelin - Elcatonin - Exenatide - Ganirelix - GHRL - GHRP-6 - Glucagon - Goserelin - Hexarelin - rHuFSH - hGHRH - hGHRP-2 - hGLP-1 - Histrelin - hLeuprolide - hLHRH - hMG - hPTH - hTSH - HuTRH - Lanreotide - Lypressin - MT-II - NAF - OCT - OT - PMSG - Pramlintide - rExendin-4 - rhCG - rhLHRH - rHuAGRP - hFSH - rHuGLP-1 - rHuGlucagon - rHuIAPP - rHuOXM - rHuProcalcitonin - rHuProguanylin - rHuProuroguanylin - rHuPTH (AS 1-34) - rHuPTH (AS 1-84) - rHuPTH (AS 7-34) - rHuSTC-1 - rHuSTC-2 - rHuThyrostimulin-A - rHuThyrostimulin-B - rHuTSH - sCT - Secretin - Sincalide - SST - Ta1 - Tb4 - Terlipressin - TP-5 - Trp - Vasopressin

Filter schließen
von bis
1 von 2
Für die Filterung wurden keine Ergebnisse gefunden!
[Des-octanoyl]-Ghrelin, human...
Ghrelin für engl. "Growth Hormone Release Inducing" ist ein appetitanregendes Hormon, welches in der Magenschleimhaut und der Bauchspeicheldrüse produziert wird. Neben der Appetitanregung hat das Hormon eine Reihe anderer Wirkungen....
ab 318,25 € * 335,00 € *
[Des-octanoyl]-Ghrelin, rat...
Ghrelin für engl. "Growth Hormone Release Inducing" ist ein appetitanregendes Hormon, welches in der Magenschleimhaut und der Bauchspeicheldrüse produziert wird. Neben der Appetitanregung hat das Hormon eine Reihe anderer Wirkungen....
ab 318,25 € * 335,00 € *
ACTH (1-10), human SYSMEHFRWG
ACTH (1-10), human SYSMEHFRWG
ACTH (1-10), human SYSMEHFRWG ist ein synthetisches Peptid entsprechend den ersten 10 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde. Insbesondere stimuliert...
ab 85,50 € * 90,00 € *
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF ist ein synthetisches Peptid entsprechend den Aminosäuren 18 bis 39 des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde....
ab 261,25 € * 275,00 € *
ACTH (4-10), human MEHFRWG
ACTH (4-10), human MEHFRWG
ACTH (4-10), human MEHFRWG ist ein synthetisches Peptid entsprechend den Aminosäuren 4 bis 10 des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde. Insbesondere stimuliert es...
ab 85,50 € * 90,00 € *
ACTH(1-39), human...
ACTH(1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ist ein synthetisches Peptid entsprechend den ersten 39 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die...
ab 441,75 € * 465,00 € *
Antide Acetate
Antide Acetate
Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s body to represses FSH and LH releases that stem from the pituitary gland. Synthetic versions of this chemical have been developed for...
ab 167,63 € *
human growth hormon releasing factor 6
GHRP6 (growth hormone releasing peptide 6) induces the secretion of growth hormone (GH). In the membrane of clonal GC somatotropes, this peptide elevates the number of functional voltage-gated Ca2+ and Na+ channels. Chronic treatment...
ab 112,50 € * 125,00 € *
Growth-hormone-releasing hormone (GHRH)
Growth-hormone-releasing hormone (GHRH)
Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or GHRF) or somatocrinin, is a 44-amino acid peptide hormone produced in the arcuate nucleus of the hypothalamus. GHRH is released from...
ab 159,65 € *
hGHRP-2 / Human Growth Hormone Releasing Peptide-2
hGHRP-2 / Human Growth Hormone Releasing Peptide-2
Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs to stimulate GH release. GHRP-2, an investigational drug, is one of the most potent...
ab 128,75 € *
hPTH - humanes Parathyroidhormon (aa 1-34)
hPTH - humanes Parathyroidhormon (aa 1-34)
Parathyroid hormone (PTH), or parathormone, is secreted by the parathyroid glands as a polypeptide of 84 amino acids. It acts to increase the concentration of calciumin in the blood, whereas calcitonin (a hormone produced by the...
ab 169,95 € *
human chorionic gonadotropin - hCG
Human Chorionic Gonadotropin (hCG)
Das menschliche Choriongonadotropin (hCG) ist ein in der Schwangerschaft erzeugtes Peptidhormon, das vom Embryo bald nach der Empfängnis und später vom Syncytiotrophoblast (Teil der Plazenta) hergestellt wird. Seine Aufgabe ist es, den...
ab 145,88 € *
1 von 2