Anti-infective peptides

Antimikrobiell wirksame Peptide (antimicrobial peptides = AMPs) bieten ein breites Spektrum antibakterieller Wirkung gegen Bakterien, Viren und Pilzen. Diese Peptide sind ein evolutionär konservierter Teil des angeborenen Immunsystems und können in allen Lebensformen gefunden werden.

Unter anderem bietet Genaxxon bioscience die folgenden Verbindungen an:
α-Defensin 5; Histatin 5; Indolicidin; LL-37; Magainin-1; Pep27; Alamethicin; Omphalotin A; Gallidermin.

Antimikrobiell wirksame Peptide (antimicrobial peptides = AMPs) bieten ein breites Spektrum antibakterieller Wirkung gegen Bakterien, Viren und Pilzen. Diese Peptide sind ein evolutionär... mehr erfahren »
Fenster schließen
Anti-infective peptides

Antimikrobiell wirksame Peptide (antimicrobial peptides = AMPs) bieten ein breites Spektrum antibakterieller Wirkung gegen Bakterien, Viren und Pilzen. Diese Peptide sind ein evolutionär konservierter Teil des angeborenen Immunsystems und können in allen Lebensformen gefunden werden.

Unter anderem bietet Genaxxon bioscience die folgenden Verbindungen an:
α-Defensin 5; Histatin 5; Indolicidin; LL-37; Magainin-1; Pep27; Alamethicin; Omphalotin A; Gallidermin.

Filter schließen
von bis
Für die Filterung wurden keine Ergebnisse gefunden!
LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
ab 174,25 € * 205,00 € *
humanes LL-37 - scrambled - GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR humanes LL-37 - scrambled -...
LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
ab 174,25 € * 205,00 € *
α-Defensin 5 human - ATCYCRTGRCATRESLSGVCEISGRLYRLCCR α-Defensin 5 human -...
α-Defensin 5 (Peptidsequenz: ATCYCRTGRCATRESLSGVCEISGRLYRLCCR) gehört zur Gruppe der antimikrobiell wirksamen Peptide (antimicrobial peptides = AMPs), die ein breites Spektrum antibakterieller Wirkung gegen Bakterien, Viren und Pilzen...
675,00 € *
Histatin 5 (Peptidsequenz: DSHAKRHHGYKRKFHEKHHSHRGY) gehört zur Gruppe der antimikrobiell wirksamen Peptide (antimicrobial peptides = AMPs), die ein breites Spektrum antibakterieller Wirkung gegen Bakterien, Viren und Pilzen bieten....
ab 195,00 € *
Indolicidin (Peptidsequenz: ILPWKWPWWPWRR-NH2) gehört zur Gruppe der antimikrobiell wirksamen Peptide (antimicrobial peptides = AMPs), die ein breites Spektrum antibakterieller Wirkung gegen Bakterien, Viren und Pilzen bieten. Peptide...
ab 195,00 € *