Für die Filterung wurden keine Ergebnisse gefunden!
humanes LL-37...
LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
ab 252,49 € * 315,62 € *
humanes LL-37 - scrambled -...
LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
ab 241,40 € * 284,00 € *
α-Defensin 5 human -...
α-Defensin 5 (Peptidsequenz: ATCYCRTGRCATRESLSGVCEISGRLYRLCCR) gehört zur Gruppe der antimikrobiell wirksamen Peptide (antimicrobial peptides = AMPs), die ein breites Spektrum antibakterieller Wirkung gegen Bakterien, Viren und Pilzen...
720,00 € *
Histatin 5: DSHAKRHHGYKRKFHEKHHSHRGY
Histatin 5 (Peptidsequenz: DSHAKRHHGYKRKFHEKHHSHRGY) gehört zur Gruppe der antimikrobiell wirksamen Peptide (antimicrobial peptides = AMPs), die ein breites Spektrum antibakterieller Wirkung gegen Bakterien, Viren und Pilzen bieten....
ab 225,00 € *
Indolicidin - ILPWKWPWWPWRR-NH2
Indolicidin (Peptidsequenz: ILPWKWPWWPWRR-NH2) gehört zur Gruppe der antimikrobiell wirksamen Peptide (antimicrobial peptides = AMPs), die ein breites Spektrum antibakterieller Wirkung gegen Bakterien, Viren und Pilzen bieten. Peptide...
ab 235,00 € *