Artikel-Nr.: P2305.9501

Shipping: shipped at RT, store at -20°C

Sofort versandfertig, Lieferzeit 1-2 Werktage

675,00 € *


Wählen Sie bitte die gewünschte Packungsgröße aus.


Wählen Sie bitte die gewünschte Reinheit aus.

α-Defensin 5 (Peptidsequenz: ATCYCRTGRCATRESLSGVCEISGRLYRLCCR) gehört zur Gruppe der... mehr
Produktinformationen "α-Defensin 5 human - ATCYCRTGRCATRESLSGVCEISGRLYRLCCR"

α-Defensin 5 (Peptidsequenz: ATCYCRTGRCATRESLSGVCEISGRLYRLCCR) gehört zur Gruppe der antimikrobiell wirksamen Peptide (antimicrobial peptides = AMPs), die ein breites Spektrum antibakterieller Wirkung gegen Bakterien, Viren und Pilzen bieten. Peptide aus dieser Gruppe sind ein evolutionär konservierter Teil des angeborenen Immunsystems und können in allen Lebensformen gefunden werden.

In der Sequenz: ATCYCRTGRCATRESLSGVCEISGRLYRLCCR sind die folgenden Cysteine über Disulfidbrücken vernetzt: 3 – 31, 5 – 20, 10 – 30.

Related products:
P2255 - Amyloid-beta (16-20) - KLVFF
P2304 - Amyloid-beta (10-20) - YEVHHQKLVFF
P2250 - Amyloid-beta (1-40) human - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide
P2248 - Amyloid-beta (1-40) rat - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide

Weitere Artikel passend zu "α-Defensin 5 human - ATCYCRTGRCATRESLSGVCEISGRLYRLCCR"
Sequence:  ATCYCRTGRCATRESLSGVCEISGRLYRLCCR with Cystein bridges at Cys3 –... mehr

Technische Daten:

Sequence: ATCYCRTGRCATRESLSGVCEISGRLYRLCCR with Cystein bridges at Cys3 – Cys31, Cys5 – Cys20, Cys10 – Cys30
Purity: >95% (HPLC).



Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "α-Defensin 5 human - ATCYCRTGRCATRESLSGVCEISGRLYRLCCR"
Bewertung schreiben
Bewertungen werden nach Überprüfung freigeschaltet.
Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein.

Die mit einem * markierten Felder sind Pflichtfelder.