Artikel-Nr.: P2306.7005

Shipping: shipped at RT, store at -20°C

Sofort versandfertig, Lieferzeit 1-2 Werktage

195,00 € *


Wählen Sie bitte die gewünschte Packungsgröße aus.


Wählen Sie bitte die gewünschte Reinheit aus.

Histatin 5 (Peptidsequenz: DSHAKRHHGYKRKFHEKHHSHRGY) gehört zur Gruppe der antimikrobiell... mehr
Produktinformationen "Histatin 5: DSHAKRHHGYKRKFHEKHHSHRGY"

Histatin 5 (Peptidsequenz: DSHAKRHHGYKRKFHEKHHSHRGY) gehört zur Gruppe der antimikrobiell wirksamen Peptide (antimicrobial peptides = AMPs), die ein breites Spektrum antibakterieller Wirkung gegen Bakterien, Viren und Pilzen bieten. Peptide aus dieser Gruppe sind ein evolutionär konservierter Teil des angeborenen Immunsystems und können in allen Lebensformen gefunden werden.

Unter anderem bietet Genaxxon bioscience die folgenden Verbindungen an: α-Defensin 5; Histatin 5; Indolicidin; LL-37; Magainin-1; Pep27; Alamethicin; Omphalotin A; Gallidermin.

Related products:

P2255 - Amyloid-beta (16-20) - KLVFF
P2304 - Amyloid-beta (10-20) - YEVHHQKLVFF
P2250 - Amyloid-beta (1-40) human - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide
P2248 - Amyloid-beta (1-40) rat - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide

Weitere Artikel passend zu "Histatin 5: DSHAKRHHGYKRKFHEKHHSHRGY"
Sequence:  DSHAKRHHGYKRKFHEKHHSHRGY Purity: >70% (HPLC). mehr

Technische Daten:

Purity: >70% (HPLC).



Sicherheits Hinweise / Safety

Klassifizierungen / Classification

Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Histatin 5: DSHAKRHHGYKRKFHEKHHSHRGY"
Bewertung schreiben
Bewertungen werden nach Überprüfung freigeschaltet.
Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein.

Die mit einem * markierten Felder sind Pflichtfelder.