Artikel-Nr.: P2306.7005

Shipping: shipped at RT, store at -20°C

Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

195,00 € *


Wählen Sie bitte die gewünschte Packungsgröße aus.


Wählen Sie bitte die gewünschte Reinheit aus.

Histatin 5 (Peptidsequenz: DSHAKRHHGYKRKFHEKHHSHRGY) gehört zur Gruppe der antimikrobiell... mehr
Produktinformationen "Histatin 5: DSHAKRHHGYKRKFHEKHHSHRGY"

Histatin 5 (Peptidsequenz: DSHAKRHHGYKRKFHEKHHSHRGY) gehört zur Gruppe der antimikrobiell wirksamen Peptide (antimicrobial peptides = AMPs), die ein breites Spektrum antibakterieller Wirkung gegen Bakterien, Viren und Pilzen bieten. Peptide aus dieser Gruppe sind ein evolutionär konservierter Teil des angeborenen Immunsystems und können in allen Lebensformen gefunden werden.

Unter anderem bietet Genaxxon bioscience die folgenden Verbindungen an: α-Defensin 5; Histatin 5; Indolicidin; LL-37; Magainin-1; Pep27; Alamethicin; Omphalotin A; Gallidermin.

Related products:
P2255 - Amyloid-beta (16-20) - KLVFF >
P2304 - Amyloid-beta (10-20) - YEVHHQKLVFF >
P2250 - Amyloid-beta (1-40) human - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >
P2248 - Amyloid-beta (1-40) rat - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >

Weitere Artikel passend zu "Histatin 5: DSHAKRHHGYKRKFHEKHHSHRGY"
Specifications: Sequence: DSHAKRHHGYKRKFHEKHHSHRGY Purity: >70% / 95% (HPLC). mehr

Technische Daten:

Purity: >70% / 95% (HPLC).



Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads