No results were found for the filter!
Prod.Nr. | Description | Price € | ||
---|---|---|---|---|
M3044.0100 | Agarose LE - Standard Agarose Agarose for different purposes with normal or high resolution separation of DNA fragments. Standard high melting point agarose for separation from 50bp up to... | Zubehör | 0,01 | |
M3049.0010 | Agarose LM - low melting This agarose is equivalent to SeaPlaque™ from Lonza. Agarose LM is a low melting agarose with a very high separation capacity for large DNA fragments (>1000... | Zubehör | 75,50 | |
S5304.10AF | Antifoam Reagent for Total RNA Purification Kit Antifoam Reagent for RNA Purification: No foam during homogenization. | Reinigungskits | 20,50 | |
M3208.1000 | Caesiumchlorid ultrapure (99,999%) Caesium chloride for density centrifugation. Ideal for the isolation of highly pure RNA without contamination with RNase, or other proteins and DNA. Ref.:... | Zubehör | 362,25 | |
M3137.0050 | cDNA One-Step RT-qPCR 2X GreenMastermix The cDNA One-Step RT-qPCR 2X master mix was developed for quantitative real-time analyzes of RNA templates with double-labeled fluorescence probes. | PCR | 102,25 | |
M3138.0250 | cDNA One-Step RT-qPCR 2X ProbeMastermix The cDNA One-Step RT-qPCR 2X master mix was developed for quantitative real-time analyzes of RNA templates with double-labeled fluorescence probes. | PCR | 408,50 | |
S5310.0100 | Ceramic beads for tissue lysis Ceramic beads for the lysis of tissue of a wide range of sample material, e.g., frozen tissue, plant tissue, cell culture cells or insects, for Total RNA... | Reinigungskits | 169,37 | |
C6003.0050 | Coronavirus 2019 Nucleocapsid Mosaic Protein The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused... | Peptides and Proteins | 225,00 | |
M3189.0020 | DEPC DEPC (Diethylpyrocarbonate) | Zubehör | 73,80 | |
M6081.0500 | Destilled water - Cell Culture Grade Sterile water for cell culture and/or diagnostic use. Delivered in Nalgene bottles or Stedim bag. This distilled water is high-quality water for use as a... | PCR | 13,55 | |
M3278.0005 | DL-Dithiothreitol (DTT) - Molecular biology grade Dithiothreitol Molecular Biology Grade. (Cleland's reagent, threo-1,4-Dimercapto-2,3-butanediol). Reduces quantitatively disulfide groups, forming a cyclic... | Zubehör | 56,50 | |
M3016.0200 | dNTP Mix (Na salt) - 10mM Premium dNTP-Set with a very favourable price : dNTPs ready-to-use aqueous solution of dATP, dCTP, dGTP and dTTP with a concentration of 100 mM each (purity:... | Zubehör | 15,00 | |
M3015.4100 | dNTP-Set (Na salt) - 100mM Premium dNTP-Set with a very favourable price : dNTPs ready-to-use aqueous solution of dATP, dCTP, dGTP and dTTP with a concentration of 100 mM each (purity:... | Zubehör | 30,00 | |
P2301.9505 | EBNA-1 Protein (562-570) FMVFLQTHI The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo... | Peptides and Proteins | 85,50 | |
M3141.0125 | Genaxx1Step RT-qPCR COVID-19 CDC Probe Assay Kit The HotScriptase RT-qPCR SARS-CoV-2 CDC Probe Assay Kit is a real-time RT-PCR-based detection system for the targets N1 and N2 of the nucleocapsid from the... | PCR | 205,00 | |
M3164.0000 | Genaxx1Step RT-qPCR SARS-CoV-2 Probe Kit Comparable with the DiaSorin Lilaison mdx kit but can be used on each PCR instrument. Genaxx1Step RT-qPCR SARS-CoV-2 Probe Kit detects the presence of the... | 55,00 | ||
S5318.0100 | GENAzol - RNA Purification solution Properties of GENAzol: - Parallel isolation of RNA, DNA and protein from the same sample - Superior suitability for lysis even with difficult samples -... | Reinigungskits | 97,50 | |
M3023.0000 | GreenMasterMix (2X) No ROX for qPCR GreenMastermix optimised for Real-Time PCR assays in block systems and capillaries that contains all components to perform quantitative PCR with the... | PCR | 20,00 | |
M3064.0000 | HotScriptase Probe RT-qPCR master mix without ROX HotScriptase Probe master mix for RT-qPCR (reverse Transcription PCR) for One-Step RT-PCR without any isothermal step for transcription of RNA! Only one... | PCR | 20,00 | |
M3056.0000 | HotScriptase RT polymerase RT-PCR (reverse Transcription) for One-Step RT-PCR without any isothermal step for transcription of RNA! Only one highly temperature stable enzyme and one... | PCR | 11,00 | |
S5344.0100 | human ACE2 Protein (ECD), Avi/His-Tag, nonbiotinylated The protein contains an Avi-Tag and is ready for invitro biotinylation. The human Angiotensin-Converting Enzyme 2 (ACE-2) is a protein highly expressed at... | Peptides and Proteins | 650,00 | |
P2299.7005 | human LL-37 [LL-37, 37 aa] LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating... | Peptides and Proteins | 196,27 | |
M3042.1010 | M-MuLV Reverse Transcriptase RNase H negative Need specific and sensitive RT-PCR? The Genaxxon bioscience M-MuLV Reverse Transcriptase, encoded by Moloney Murine Leukemia Virus (M-MuLV RT) and expressed... | PCR | 110,14 | |
S5305.0010 | miRNA Purification Mini Spin Kit Phenol free miRNA Extraction and Purification Kit designed for the rapid, parallel and efficient purification of high quality RNA including tRNA, 5S rRNA,... | Reinigungskits | 41,91 | |
M6340.1050 | Nuclease and DNA-free Water for PCR Pure, quality tested, nuclease-free water is suitable for use in all experiments that require nuclease-free water, including molecular biology applications.... | PCR | 13,50 | |
M3039.0150 | Oligo dT20 primer Oligo(dT)20 Primer is suitable for use in first-strand cDNA synthesis with reverse transcriptase. The primer hybridizes to the poly(A) tail of mRNA. It is... | PCR | 21,66 | |
M3068.0100 | One-Step cDNA RT-PCR Kit The cDNA RT-PCR One-Step Kit is designed for performing highly sensitive and specific RT-PCR. The kit is based on a genetically engineered reverse... | PCR | 462,99 | |
M3136.0250 | One-Step cDNA RT-PCR master mix (2X) - improved The cDNA RT-PCR One-Step Kit is designed for performing highly sensitive and specific RT-PCR. The kit is based on a genetically engineered reverse... | PCR | 325,00 | |
M3139.0050 | PHOENIXDX® 2019-NCOV PHOENIXDX® 2019-NCOV is a real-time RT-PCR-based detection system for the 2019 Wuhan coronavirus (2019-nCoV). PHOENIXDX® 2019-NCOV detects the presence of... | PCR | 475,00 | |
M3045.0000 | ProbeMasterMix No ROX for qPCR ProbeMastermix optimised for realtime PCR assays in block systems that contains all components to perform quantitative PCR with the exception of primer and... | PCR | 20,00 | |
M3037.0005 | Proteinase K solution (20mg/mL) Proteinase K from Tritirachium album belongs to the familiy of subtilisin-like serine proteases. Activated by calcium, Proteinase K exhibits a broad... | Zubehör | 10,50 | |
M3038.0125 | Random Hexamer Primer N6 Random Hexamers are short oligodeoxyribonucleotides of random sequence [d(N)6]. Primers are quality controlled (MS), purified (reversed phase HPLC),... | PCR | 21,66 | |
C6018.0020 | rec. Human Interferon-Gamma (rHulFN-g) Recombinant Human IFN-g produced in E.Coli is a single, non-glycosylated, polypeptide chain of 144 amino acids and amolecular mass of 16,879 Dalton.... | Peptides and Proteins | 145,00 | |
M3034.2000 | recombinant RNase Inhibitor - RNasin RNase inhibitor inactivates RNase by binding to the enzyme at a ratio of 1:1. RNase can be reactivated from this complex by addition of 7 M urea or heat... | PCR | 103,65 | |
S5231.0100 | Ribonuclease A (RNase A) RNAse A from bovine pancreas. Pancreatic ribonuclease (RNase) is an endoribonuclease. It catalyzes the cleavage of the phosphodiester bond between the... | Zubehör | 48,03 | |
S5304.0250L | RLys - Lysis buffer for RNA Purification Kit Buffer RLys is a lysis buffer for lysing cells and tissues prior to RNA isolation and simultaneous RNA/DNA/Protein isolation. | Reinigungskits | 113,30 | |
S5320.0010 | RNA Purification from Bacteria and Yeast Kit Phenol free RNA Extraction and Purification Kit designed for the rapid and efficient purification of high quality RNA from bacteria or yeast cultures or... | Reinigungskits | 39,79 | |
S5311.0050 | RNA Purification mini spin columns Genaxxon RNA purification spin columns for RNA purification kits of different suppliers, cheap alternative if buffers of already existing RNA-purification... | Reinigungskits | 63,10 | |
M3231.0010 | RNA/DNA Extraction Solution Q-Extract DNA Extraction Solution provides fast and easy extraction of nucleic acids from various mammalian tissues (e.g. mouse tails, ear snips, liver,... | Reinigungskits | 55,00 | |
S5340.0100 | SARS-CoV-2 (2019-nCoV) Spike S1 Protein (RBD) The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe... | Peptides and Proteins | 995,00 | |
S5347.0050 | SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.)... | Peptides and Proteins | 225,00 | |
S5345.0050 | SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain is derived as a recombinant protein from E.Coli. The protein contains the Coronavirus... | Peptides and Proteins | 225,00 | |
S5346.0050 | SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (800-1000 a.a.)... | Peptides and Proteins | 225,00 | |
S5343.0050 | SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and... | Peptides and Proteins | 225,00 | |
S5341.0050 | SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag... | Peptides and Proteins | 995,00 | |
S5342.0050 | SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc... | Peptides and Proteins | 995,00 | |
S5304.0010 | Total RNA Purification Mini Spin Kit Genaxxon´s Total RNA Purification Mini Spin kit is designed for the rapid and efficient purification of high quality RNA from 1-30mg of tissue (fresh or... | Reinigungskits | 39,79 | |
S5301.0250 | Viral RNA Purification Kit Viral RNA and DNA purification from a variety of pathogen organisms such as virus or bacteria. Samples can be fresh or frozen plasma/blood (treated with... | Reinigungskits | 725,00 |
1