Covid 19 - Sars-CoV-2 - Resrearch - Products

For your SARS-CoV-2 research, you will find the following COVID-19 research products available at Genaxxon here:

- Peptides and more: We offer SARS spike peptides and proteins for a variety of research areas, such as the development of vaccines and therapeutics against SARS-CoV-2:
Genaxxon provides you with SARS-CoV-2 (2019-nCoV) spike proteins with various important sequence sections.
- RNA isolation: RT-PCR without isothermal intermediate step
- SARS-CoV-2 detection (also directyl from samples without prior RNA extraction)
- cDNA One-Step RT-PCR
- RNA purification kits

The prices shown refer to the basic packaging unit.
In the list below, you can select the SARS-CoV-2 product with further packaging units, information etc. that best suits your research.

You will find an overview of our SARS-CoV-2 products here >

For your SARS-CoV-2 research, you will find the following COVID-19 research products available at Genaxxon here: - Peptides and more: We offer SARS spike peptides and proteins for a variety... read more »
Close window

Covid 19 - Sars-CoV-2 - Resrearch - Products

For your SARS-CoV-2 research, you will find the following COVID-19 research products available at Genaxxon here:

- Peptides and more: We offer SARS spike peptides and proteins for a variety of research areas, such as the development of vaccines and therapeutics against SARS-CoV-2:
Genaxxon provides you with SARS-CoV-2 (2019-nCoV) spike proteins with various important sequence sections.
- RNA isolation: RT-PCR without isothermal intermediate step
- SARS-CoV-2 detection (also directyl from samples without prior RNA extraction)
- cDNA One-Step RT-PCR
- RNA purification kits

The prices shown refer to the basic packaging unit.
In the list below, you can select the SARS-CoV-2 product with further packaging units, information etc. that best suits your research.

You will find an overview of our SARS-CoV-2 products here >

Close filters
from to
No results were found for the filter!
Prod.Nr. Description     Price €
M3044.0100 Agarose LE - Standard Agarose 
Agarose for different purposes with normal or high resolution separation of DNA fragments. Standard high melting point agarose for separation from 50bp up to...
Zubehör 0,01
M3049.0010 Agarose LM - low melting 
This agarose is equivalent to SeaPlaque™ from Lonza. Agarose LM is a low melting agarose with a very high separation capacity for large DNA fragments (>1000...
Zubehör 75,50
S5304.10AF Antifoam Reagent for Total RNA Purification Kit 
Antifoam Reagent for RNA Purification: No foam during homogenization.
Reinigungskits 20,50
M3208.1000 Caesiumchlorid ultrapure (99,999%) 
Caesium chloride for density centrifugation. Ideal for the isolation of highly pure RNA without contamination with RNase, or other proteins and DNA. Ref.:...
Zubehör 362,25
M3137.0050 cDNA One-Step RT-qPCR 2X GreenMastermix 
The cDNA One-Step RT-qPCR 2X master mix was developed for quantitative real-time analyzes of RNA templates with double-labeled fluorescence probes.
PCR 102,25
M3138.0250 cDNA One-Step RT-qPCR 2X ProbeMastermix 
The cDNA One-Step RT-qPCR 2X master mix was developed for quantitative real-time analyzes of RNA templates with double-labeled fluorescence probes.
PCR 408,50
S5310.0100 Ceramic beads for tissue lysis 
Ceramic beads for the lysis of tissue of a wide range of sample material, e.g., frozen tissue, plant tissue, cell culture cells or insects, for Total RNA...
Reinigungskits 169,37
C6003.0050 Coronavirus 2019 Nucleocapsid Mosaic Protein 
The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused...
Peptides and Proteins 225,00
M3189.0020 DEPC 
DEPC (Diethylpyrocarbonate)
Zubehör 73,80
M6081.0500 Destilled water - Cell Culture Grade 
Sterile water for cell culture and/or diagnostic use. Delivered in Nalgene bottles or Stedim bag. This distilled water is high-quality water for use as a...
PCR 13,55
M3278.0005 DL-Dithiothreitol (DTT) - Molecular biology grade 
Dithiothreitol Molecular Biology Grade. (Cleland's reagent, threo-1,4-Dimercapto-2,3-butanediol). Reduces quantitatively disulfide groups, forming a cyclic...
Zubehör 56,50
M3016.0200 dNTP Mix (Na salt) - 10mM 
Premium dNTP-Set with a very favourable price : dNTPs ready-to-use aqueous solution of dATP, dCTP, dGTP and dTTP with a concentration of 100 mM each (purity:...
Zubehör 15,00
M3015.4100 dNTP-Set (Na salt) - 100mM 
Premium dNTP-Set with a very favourable price : dNTPs ready-to-use aqueous solution of dATP, dCTP, dGTP and dTTP with a concentration of 100 mM each (purity:...
Zubehör 30,00
P2301.9505 EBNA-1 Protein (562-570) FMVFLQTHI 
The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo...
Peptides and Proteins 85,50
M3141.0125 Genaxx1Step RT-qPCR COVID-19 CDC Probe Assay Kit 
The HotScriptase RT-qPCR SARS-CoV-2 CDC Probe Assay Kit is a real-time RT-PCR-based detection system for the targets N1 and N2 of the nucleocapsid from the...
PCR 205,00
M3164.0000 Genaxx1Step RT-qPCR SARS-CoV-2 Probe Kit 
Comparable with the DiaSorin Lilaison mdx kit but can be used on each PCR instrument. Genaxx1Step RT-qPCR SARS-CoV-2 Probe Kit detects the presence of the...
S5318.0100 GENAzol - RNA Purification solution 
Properties of GENAzol: - Parallel isolation of RNA, DNA and protein from the same sample - Superior suitability for lysis even with difficult samples -...
Reinigungskits 97,50
M3023.0000 GreenMasterMix (2X) No ROX for qPCR 
GreenMastermix optimised for Real-Time PCR assays in block systems and capillaries that contains all components to perform quantitative PCR with the...
PCR 20,00
M3064.0000 HotScriptase Probe RT-qPCR master mix without ROX 
HotScriptase Probe master mix for RT-qPCR (reverse Transcription PCR) for One-Step RT-PCR without any isothermal step for transcription of RNA! Only one...
PCR 20,00
M3056.0000 HotScriptase RT polymerase 
RT-PCR (reverse Transcription) for One-Step RT-PCR without any isothermal step for transcription of RNA! Only one highly temperature stable enzyme and one...
PCR 11,00
S5344.0100 human ACE2 Protein (ECD), Avi/His-Tag, nonbiotinylated 
The protein contains an Avi-Tag and is ready for invitro biotinylation. The human Angiotensin-Converting Enzyme 2 (ACE-2) is a protein highly expressed at...
Peptides and Proteins 650,00
LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating...
Peptides and Proteins 196,27
M3042.1010 M-MuLV Reverse Transcriptase RNase H negative 
Need specific and sensitive RT-PCR? The Genaxxon bioscience M-MuLV Reverse Transcriptase, encoded by Moloney Murine Leukemia Virus (M-MuLV RT) and expressed...
PCR 110,14
S5305.0010 miRNA Purification Mini Spin Kit 
Phenol free miRNA Extraction and Purification Kit designed for the rapid, parallel and efficient purification of high quality RNA including tRNA, 5S rRNA,...
Reinigungskits 41,91
M6340.1050 Nuclease and DNA-free Water for PCR 
Pure, quality tested, nuclease-free water is suitable for use in all experiments that require nuclease-free water, including molecular biology applications....
PCR 13,50
M3039.0150 Oligo dT20 primer 
Oligo(dT)20 Primer is suitable for use in first-strand cDNA synthesis with reverse transcriptase. The primer hybridizes to the poly(A) tail of mRNA. It is...
PCR 21,66
M3068.0100 One-Step cDNA RT-PCR Kit 
The cDNA RT-PCR One-Step Kit is designed for performing highly sensitive and specific RT-PCR. The kit is based on a genetically engineered reverse...
PCR 462,99
M3136.0250 One-Step cDNA RT-PCR master mix (2X) - improved 
The cDNA RT-PCR One-Step Kit is designed for performing highly sensitive and specific RT-PCR. The kit is based on a genetically engineered reverse...
PCR 325,00
M3139.0050 PHOENIXDX® 2019-NCOV 
PHOENIXDX® 2019-NCOV is a real-time RT-PCR-based detection system for the 2019 Wuhan coronavirus (2019-nCoV). PHOENIXDX® 2019-NCOV detects the presence of...
PCR 475,00
M3045.0000 ProbeMasterMix No ROX for qPCR 
ProbeMastermix optimised for realtime PCR assays in block systems that contains all components to perform quantitative PCR with the exception of primer and...
PCR 20,00
M3037.0005 Proteinase K solution (20mg/mL) 
Proteinase K from Tritirachium album belongs to the familiy of subtilisin-like serine proteases. Activated by calcium, Proteinase K exhibits a broad...
Zubehör 10,50
M3038.0125 Random Hexamer Primer N6 
Random Hexamers are short oligodeoxyribonucleotides of random sequence [d(N)6]. Primers are quality controlled (MS), purified (reversed phase HPLC),...
PCR 21,66
C6018.0020 rec. Human Interferon-Gamma (rHulFN-g) 
Recombinant Human IFN-g produced in E.Coli is a single, non-glycosylated, polypeptide chain of 144 amino acids and amolecular mass of 16,879 Dalton....
Peptides and Proteins 145,00
M3034.2000 recombinant RNase Inhibitor - RNasin 
RNase inhibitor inactivates RNase by binding to the enzyme at a ratio of 1:1. RNase can be reactivated from this complex by addition of 7 M urea or heat...
PCR 103,65
S5231.0100 Ribonuclease A (RNase A) 
RNAse A from bovine pancreas. Pancreatic ribonuclease (RNase) is an endoribonuclease. It catalyzes the cleavage of the phosphodiester bond between the...
Zubehör 48,03
S5304.0250L RLys - Lysis buffer for RNA Purification Kit 
Buffer RLys is a lysis buffer for lysing cells and tissues prior to RNA isolation and simultaneous RNA/DNA/Protein isolation.
Reinigungskits 113,30
S5320.0010 RNA Purification from Bacteria and Yeast Kit 
Phenol free RNA Extraction and Purification Kit designed for the rapid and efficient purification of high quality RNA from bacteria or yeast cultures or...
Reinigungskits 39,79
S5311.0050 RNA Purification mini spin columns 
Genaxxon RNA purification spin columns for RNA purification kits of different suppliers, cheap alternative if buffers of already existing RNA-purification...
Reinigungskits 63,10
M3231.0010 RNA/DNA Extraction Solution 
Q-Extract DNA Extraction Solution provides fast and easy extraction of nucleic acids from various mammalian tissues (e.g. mouse tails, ear snips, liver,...
Reinigungskits 55,00
S5340.0100 SARS-CoV-2 (2019-nCoV) Spike S1 Protein (RBD) 
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe...
Peptides and Proteins 995,00
S5347.0050 SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) 
SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.)...
Peptides and Proteins 225,00
S5345.0050 SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain 
SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain is derived as a recombinant protein from E.Coli. The protein contains the Coronavirus...
Peptides and Proteins 225,00
S5346.0050 SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) 
SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (800-1000 a.a.)...
Peptides and Proteins 225,00
S5343.0050 SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic 
SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and...
Peptides and Proteins 225,00
S5341.0050 SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag...
Peptides and Proteins 995,00
S5342.0050 SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc...
Peptides and Proteins 995,00
S5304.0010 Total RNA Purification Mini Spin Kit 
Genaxxon´s Total RNA Purification Mini Spin kit is designed for the rapid and efficient purification of high quality RNA from 1-30mg of tissue (fresh or...
Reinigungskits 39,79
S5301.0250 Viral RNA Purification Kit 
Viral RNA and DNA purification from a variety of pathogen organisms such as virus or bacteria. Samples can be fresh or frozen plasma/blood (treated with...
Reinigungskits 725,00