No results were found for the filter!
Prod.Nr. | Description | Price € | ||
---|---|---|---|---|
C6003.0050 | Coronavirus 2019 Nucleocapsid Mosaic Protein The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused... | Peptides and Proteins | 225,00 | |
P2301.9505 | EBNA-1 Protein (562-570) FMVFLQTHI The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo... | Peptides and Proteins | 85,50 | |
P2299.7005 | human LL-37 [LL-37, 37 aa] LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating... | Peptides and Proteins | 196,27 | |
C6018.0020 | rec. Human Interferon-Gamma (rHulFN-g) Recombinant Human IFN-g produced in E.Coli is a single, non-glycosylated, polypeptide chain of 144 amino acids and amolecular mass of 16,879 Dalton.... | Peptides and Proteins | 145,00 | |
S5340.0100 | SARS-CoV-2 (2019-nCoV) Spike S1 Protein (RBD) The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe... | Peptides and Proteins | 995,00 | |
S5347.0050 | SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.)... | Peptides and Proteins | 225,00 | |
S5345.0050 | SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain is derived as a recombinant protein from E.Coli. The protein contains the Coronavirus... | Peptides and Proteins | 225,00 | |
S5346.0050 | SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (800-1000 a.a.)... | Peptides and Proteins | 225,00 | |
S5343.0050 | SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and... | Peptides and Proteins | 225,00 | |
S5341.0050 | SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag... | Peptides and Proteins | 995,00 | |
S5342.0050 | SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc... | Peptides and Proteins | 995,00 |
1