Peptides and recombinant proteins for COVID-19 research

We offer SARS spike peptides and proteins for multiple research directions such as the development of vaccines and therapeutics against SARS-CoV-2:
At Genaxxon, you can get SARS-CoV-2 (2019-nCoV) spike proteins with diverse key sequence segments.
The spike (S) glycoprotein contains S1 and S2 subunits that mediate binding to and fusion with the human ACE2 transmembrane protein used by the virus as an entry point into the human host cell at the beginning of an infection process.

ACE2 is widely expressed throughout the human body (e.g., in tongue epithelia, B cells, T cells and macrophages in the oral mucosa, type II alveolar cells, and myocardiocytes). Because the S-glycoprotein is essential for ACE2 receptor recognition, binding, and entry into host cells, it is lein logical antigenic target for the development of a SARS-CoV-2 vaccine and therapeutics in COVID-19 treatment.
Xu et al. "High expression of ACE2 receptor of 2019-nCoV on the epithelial cells of oral mucosa." Int J Oral Sci 12, 8 (2020). https://doi.org/10.1038/s41368-020-0074-x.

- SARS-CoV-2 (2019-nCoV) spike S1 and S2 proteins, RBD.
- SARS-CoV-2 coronavirus 2019 spike e-mosaic.
- Coronavirus 2019 Nucleocapsid Mosaic Protein.

In the following list, you can choose the SARS spike protein that is most suitable for your research.

We offer SARS spike peptides and proteins for multiple research directions such as the development of vaccines and therapeutics against SARS-CoV-2: At Genaxxon, you can get SARS-CoV-2 (2019-nCoV)... read more »
Close window
Peptides and recombinant proteins for COVID-19 research

We offer SARS spike peptides and proteins for multiple research directions such as the development of vaccines and therapeutics against SARS-CoV-2:
At Genaxxon, you can get SARS-CoV-2 (2019-nCoV) spike proteins with diverse key sequence segments.
The spike (S) glycoprotein contains S1 and S2 subunits that mediate binding to and fusion with the human ACE2 transmembrane protein used by the virus as an entry point into the human host cell at the beginning of an infection process.

ACE2 is widely expressed throughout the human body (e.g., in tongue epithelia, B cells, T cells and macrophages in the oral mucosa, type II alveolar cells, and myocardiocytes). Because the S-glycoprotein is essential for ACE2 receptor recognition, binding, and entry into host cells, it is lein logical antigenic target for the development of a SARS-CoV-2 vaccine and therapeutics in COVID-19 treatment.
Xu et al. "High expression of ACE2 receptor of 2019-nCoV on the epithelial cells of oral mucosa." Int J Oral Sci 12, 8 (2020). https://doi.org/10.1038/s41368-020-0074-x.

- SARS-CoV-2 (2019-nCoV) spike S1 and S2 proteins, RBD.
- SARS-CoV-2 coronavirus 2019 spike e-mosaic.
- Coronavirus 2019 Nucleocapsid Mosaic Protein.

In the following list, you can choose the SARS spike protein that is most suitable for your research.

Close filters
  •  
 
from to
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
No results were found for the filter!
Prod.Nr. Description     Price €
C6003.0050 Coronavirus 2019 Nucleocapsid Mosaic Protein 
The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused...
Peptides and Proteins 225,00
P2301.9505 EBNA-1 Protein (562-570) FMVFLQTHI 
The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo...
Peptides and Proteins 85,50
S5349.0100 hACE2 Protein (ECD, processed), Tag-free 
The human Angiotensin-Converting Enzyme 2 (ACE-2) is a protein highly expressed at the surface of cells of the human lungs, arteries, kidney, heart and...
Peptides and Proteins 590,00
S5361.0100 human ACE2 Protein (ECD), Avi/His-Tag, biotinylated 
The protein contains an Avi-Tag and is ready for invitro biotinylation. The human Angiotensin-Converting Enzyme 2 (ACE-2) is a protein highly expressed at...
Peptides and Proteins 890,00
S5344.0100 human ACE2 Protein (ECD), Avi/His-Tag, non-biotinylated 
The protein contains an Avi-Tag and is ready for invitro biotinylation. The human Angiotensin-Converting Enzyme 2 (ACE-2) is a protein highly expressed at...
Peptides and Proteins 590,00
P2299.9501 human LL-37 [LL-37, 37 aa] 
LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating...
Peptides and Proteins 174,25
C6018.0020 rec. Human Interferon-Gamma (rHulFN-g) 
Recombinant Human IFN-g produced in E.Coli is a single, non-glycosylated, polypeptide chain of 144 amino acids and amolecular mass of 16,879 Dalton....
Peptides and Proteins 145,00
S5334.0100 SARS-CoV-2 (2019-nCoV) Spike S1 Protein (RBD) - without Tag 
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe...
Peptides and Proteins 199,00
S5340.0100 SARS-CoV-2 (2019-nCoV) Spike S1 Protein (RBD) with His-Tag 
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe...
Peptides and Proteins 300,00
S5333.0100 SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilized Trimer 
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe...
Peptides and Proteins 480,00
S5348.0100 SARS-CoV-2 (COVID-19) Nucleocapsid protein - (1-419), His-Tag 
Beneath its envelope membrane, the new coronavirus SARS-CoV-2 consists of a icosaedric nucleocapsid that contains its genectic information in form of...
Peptides and Proteins 420,00
S5347.0050 SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) 
SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.)...
Peptides and Proteins 225,00
S5345.0050 SARS-CoV-2 Coronavirus 2019 Spike (300-600) RBD 
SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain is derived as a recombinant protein from E.Coli. The protein contains the Coronavirus...
Peptides and Proteins 225,00
S5346.0050 SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) 
SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (800-1000 a.a.)...
Peptides and Proteins 225,00
S5343.0050 SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic - with His-Tag 
SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and...
Peptides and Proteins 225,00
S5341.0050 SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag...
Peptides and Proteins 995,00
S5342.0050 SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc...
Peptides and Proteins 995,00
1