{ page.metaInformation.metaTitle}}

Caesium chloride for density centrifugation. Ideal for the isolation of highly pure RNA without contamination with RNase, or other proteins and DNA. Ref.: Miller H. (1987) Methods Enzymol., 152, 145, Dorin M. and Bornecque C.A. (1995) BioTechniques, 18,90.

Clostridium histolyticum collagenase is an enzyme mixture of collagenase, clostripain and tryptic and proteolytic activities. Collagenase type III shows normal Collagenase, but very low proteolytic activity. Type III Collagenase is recommended for preparation of cells from mamary gland and fetal cells and has a specific activity of 100 to 250 Mandl units per mg of dry matter. Collagenase is produced by two separate and distinct genes in Clostridium histolyticum. Both genes have been cloned and sequenced (Yoshihara 1994). The colG gene codes for type I collagenase, a 936 amino acid protein, while the colH gene codes for type II collagenase, a 1021 amino acid protein. Both genes share 72% identity, the proteins only 43%. Both gene products can be present as two or more isoforms differing in molecular weight. Therefore collagenase mixtures can contain six to eight different proteins in a molecular weight range from 68 to 130 kDa. Substrate specificity studies have demonstrated that the colG gene prefers natural substrates such as intact collagen, compared to the colH gene product which preferentially digests short synthetic substrates (FALGPA) (Eckhard et al. 2009 and Matsushita 1999). General description:The treatment of tissue with collagenase causes the careful, selective degradation of the intercellular matrix, and does not affect the growth of the cells. The collagenase offered by Genaxxon bioscience is a mixture of different proteolytically active enzymes and requires calcium ions for both the catalytic activity and the binding to the collagen molecule. In contrast to vertebrate collagenase, Clostridium histolyticum collagenase digests native triple helix collagen into small peptides, which is the major use of collagenases in cell culture application. For optimal results, a well balanced mixture of proteolytic enzymes is necessary. Four different collagenases, Collagenase Type I >, Collagenase Type II >, Collagenase Type III > and Collagenase Type IV > are available for this. Type IV is usually used together with other enzymes, such as trypsin >, elastase or hyaluronidase >. Trypsin or Trypsin/EDTA > conventionally used in the cell culture degrades the matrix only slowly and can cause irreversible damage to the released cells. Therefore, we recommend Accutase > instead of trypsin or trypsin/EDTA. Clostridium collagenases belongs to the metalloproteases, a large family of proteases that shares a zinc-containing motif at the center of the active site (Gonzales and Robert-Baudouy 1996). The enzyme is reversibly inactivated at high pH values and irreversibly inactivated at low pH values. Inhibitors of collagenase include cysteine, EDTA, o-phenanthroline, 8-hydroxyquinoline-5-sulfonate, bipyridyl, 2,3-dimercaptopropanol or Hg2+, Pb2+, Cd2+, Cu2+. Collagenase is NOT inhibited by diisopropylphosphorofluoridate (DFP) or serum. Lyphilised Collagenase should be stored at +2°C to +8°C and remain stable without loss of activity for at least three years. Enzyme should be protected from moisture. Dissolved Collagenase can be aliquoted and stored at -20°C for one year. Conversion rates of collagenase activity units: 1 PZ U/mg ~ 3.9 FALGPA U/mg - 1 PZ U/mg ~ 1000 Mandl or CDU U/mg - 1 PZ U/mg ~ 10 HP U/mg (PZ-units according to Wünsch).

Zymolyase®, produced by a submerged culture of Arthrobacter luteus, has strong lytic activity against living yeast cell walls to produce protoplast or spheroplast of various strains of yeast cells. An essential enzyme for the lytic activity of Zymolyase® is β-1,3-glucan laminaripentaohydrolase. It hydrolyzes linear glucose polymers with β-1,3-linkages and releases specifically laminaripentaose as the main and minimum product unit. Reported to be useful for lysis of Ashbya, Candida, Debaryomyces, Eremothecium, Endomyces, Hansenula, Hanseniaspora, Kloeckera, Kluyveromyces, Lipomyces, Metschikowia, Pichia, Pullularia, Torulopsis, Saccharomyces, Saccharomycopsis, Saccharomycodes, and Schwanniomyces species. There are two preparations of Zymolyase®, Zymolyase®-20T (C4352) and Zymolyase®-100T (C4366) , having lytic activity of 20,000 units/g and 100,000 units/g respectively. The activity was tested towards brewer’s yeast cells (Saccharomyces cerevisiae, resting stage) or towar yeast cells of Saccharomyces uvarum (IFO 0565) cultured statically in malt extract medium. Zymolyase®-20T is ammonium sulfate precipitate while Zymolyase®-100T is a further purified preparation by affinity chromatography. Lytic activity varies depending on yeast strain, growth stage of yeast, or cultural conditions. Further informations related to Zymolyase® can be obtained from the data sheet and the references given there.

Phleomycin belongs to the bleomycin antibiotic family exhibiting in vivo activity against bacteria, eukaryotic microorganisms, plants and animal cells. Phleomycin undergoes irresversible denaturation at pH4.0 and below. It is a mixture of different Bleomycin salts. Bleomycin itselves finds use as a cytostatic drug in chemotherapy because it causes double-strand breaks in the DNA. It binds and intercalates DNA thus destroying the integrity of the double helix. Phleomycin is active against most bacteria, filamentous fungi, yeast, plant and animal cells. Use of phleomycin is recommended for cells poorly sensitive to Zeocin®, i.e. filamentous fungi and some yeasts. Phleomycin resistance is conferred by the Sh ble gene from Streptoalloteichus hindustanus which encodes a protein that binds to phleomycin, inhibiting its DNA cleavage activity. Typically, phleomycin is used at a concentration of 10µg/µL (yeasts) and 25-150,µg/µL (filamentous fungi). Zeocin® is a trade mark of InvivoGen USA.

Exosome Ultra are lyophilized exosomes that can be used as reference material/standard for your exosome research. Simply dissolve the lyophilized exosomes in sterile water for immediate use. Origin: Human MSC.Exosomes are small, nanoscale extracellular vesicles (membrane-enclosed particles of 30 - 120nm) derived from endosomes, and are secreted continiously by cells. Among other things, exosomes are extremely important in cell-cell communication (cell signaling) and can provide extremely valuable information about the protein, lipid, metabolite and nucleic acid composition of the original mother cell. Examination of the content of the exosomes can provide information on cell health, overall disease status and more. Therefore exosomes are studied to be used for diagnostic purposes especially as it has been shown that exosomes play a role in cancer, neurodegenerative diseases and cardiovascular diseases.

Trypsin from bovine pancreas, Tryptic activity (BAEE): min. 2500 U/mg. Lyophilised. No P. aeruginosa, Salmonella, Staphyloccus aureus detectable. Activity: 1g of Trypsin digests 250g of Casein substrate. Synonym: Peptidylpeptid-Hydrolase (E.C. 3.4.21.4).

N-acetyl-L-alanyl-L-glutamine (stable glutamine) for cell culture. L-glutamine is an essential amino acid that is essential for cell growth. While normal L-glutamine undergoes autohydrolysis and is therefore not stable in solution, it can be substituterd by the addition of stable N-acetyl-L-alanyl-L-glutamine which guarantees cell culture medium still containing "L-Glutamine" even after 2 years storage. N-acetyl-L-alanyl-L-glutamine is cleaved by cellular aminopeptidases into alanine and glutamine, providing the cell with the necessary supply of L-glutamine for growth. Mechanism:When cells are cultured in N-acetyl-L-alanyl-L-glutamine containing media, the cells gradually release aminopeptidases which hydrolyze the dipeptide, slowly releasing L-alanine and L-glutamine into the culture medium. L-glutamine and L-alanine can then be taken up by the cells and used for protein production or in the TCA cycle. This mechanism can be compared to the fed-batch culture strategy in which L-glutamine is continuously fed into the culture but kept at a low concentration. The result is an efficient energy metabolism and a high growth yield without excess ammonia.

Synonyms: Parathyrin, PTH, Parathormone. Rec. Parathyroid Hormone Human (C181H290N55O51S2) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 34 amino acids and having a molecular mass of 4117.8 Dalton.

Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s body to represses FSH and LH releases that stem from the pituitary gland. Synthetic versions of this chemical have been developed for use/controlling of these reactions in a laboratory setting, both as a means to determine a potential medical use for antide acetate and to help researchers better understand the role of this chemical in an animal’s body when it is naturally produced. Antide acetate that is prepared for laboratory use is provided as a lyophilized sterile powder that can be reconstituted with an aqueous solution as necessary for the given application. Researchers are encouraged to seek out a supply that is prepared without additives, to ensure accurate and reliable testing results once the chemical is in use. Synonym: Ac-D-2-Nal-4-chloro-D-Phe-β-(3-pyridyl)-D-Ala-Ser-Lys(nicotinoyl)-D-Lys(nicotinoyl)-Leu-Lys(isopropyl)-Pro-D-Ala-NH₂ acetate salt.

Zymolyase®, produced by a submerged culture of Arthrobacter luteus, has strong lytic activity against living yeast cell walls to produce protoplast or spheroplast of various strains of yeast cells. An essential enzyme for the lytic activity of Zymolyase® is β-1,3-glucan laminaripentaohydrolase. It hydrolyzes linear glucose polymers with β-1,3-linkages and releases specifically laminaripentaose as the main and minimum product unit. Reported to be useful for lysis of Ashbya, Candida, Debaryomyces, Eremothecium, Endomyces, Hansenula, Hanseniaspora, Kloeckera, Kluyveromyces, Lipomyces, Metschikowia, Pichia, Pullularia, Torulopsis, Saccharomyces, Saccharomycopsis, Saccharomycodes, and Schwanniomyces species. There are two preparations of Zymolyase®, Zymolyase®-20T (C4352) and Zymolyase®-100T (C4366), having lytic activity of 20,000 units/g and 100,000 units/g respectively. The activity was tested towards brewer’s yeast cells (Saccharomyces cerevisiae, resting stage) or towar yeast cells of Saccharomyces uvarum (IFO 0565) cultured statically in malt extract medium. Zymolyase®-20T is ammonium sulfate precipitate while Zymolyase®-100T is a further purified preparation by affinity chromatography. Lytic activity varies depending on yeast strain, growth stage of yeast, or cultural conditions. Further informations related to Zymolyase® can be obtained from the data sheet and the references given there.

Follicle stimulating hormone (FSH) is a hormone synthesised and secreted by gonadotropes in the anterior pituitary gland. FSH and LH act synergistically in reproduction in women, in the ovary FSH stimulates the growth of immature Graafian follicles to maturation. As the follicle grows it releases inhibin, which shuts off the FSH production. In men, FSH enhances the production of androgen-binding proteinby the Sertoli cells of the testes and is critical for spermatogenesis. In both males and females, FSH stimulates the maturation of germ cells. In females, FSH initiates follicular growth, specifically affecting granulosa cells. With the concomitant rise in Inhibin B, FSH levels decline in the late follicular phase. This seems to be critical in selecting only the most advanced follicle to proceed to ovulation. At the end of the luteal phase, there is a slight rise in FSH that seems to be of importance to start the next ovulatory cycle. Like its partner, LH, FSH release at the pituitary gland is controlled by pulses of gonadotropin-releasing hormone(GnRH). Those pulses, in turn, are subject to the estrogen feed-back from the gonads.

CRH is a powerful stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. CRH concentration in the human peripheral circulation is usually low. The concentration rises during pregnancy and fall back quickly after parturition. Maternal plasma CRH most likely originates from the placenta. Human plasma has a CRH-binding protein that inactivates CRH and can inhibit inappropriate pituitary-adrenal stimulation in pregnancy. Human recombinant CRHBP is a 34.58 kDa protein containing 308 aa and fused to a 10 aa N-Terminal His-tag. Synonyms: Corticotropin releasing hormone binding protein, CRF-BP, CRH-BP, CRF-binding protein. Amino acid sequence: MKHHHHHHAS YLELREAADY DPFLLFSANL KRELAGEQPY RRALRCLDML SLQGQFTFTA DRPQLHCAAF FISEPEEFIT IHYDQVSIDC QGGDFLKVFD GWILKGEKFP SSQDHPLPSA ERYIDFCESG LSRRSIRSSQ NVAMIFFRVH EPGNGFTLTI KTDPNLFPCN VISQTPNGKF TLVVPHQHRN CSFSIIYPVV IKISDLTLGH VNGLQLKKSS AGCEGIGDFV ELLGGTGLDP SKMTPLADLC YPFHGPAQMK VGCDNTVVRM VSSGKHVNRV TFEYRQLEPY ELENPNGNSI GEFCLSGL YLELREAADY DPFLLFSANL KRELAGEQPY RRALRCLDML SLQGQFTFTA DRPQLHCAAF FISEPEEFIT IHYDQVSIDC QGGDFLKVFD GWILKGEKFP SSQDHPLPSA ERYIDFCESG LSRRSIRSSQ NVAMIFFRVH EPGNGFTLTI KTDPNLFPCN VISQTPNGKF TLVVPHQHRN CSFSIIYPVV IKISDLTLGH VNGLQLKKSS AGCEGIGDFV ELLGGTGLDP SKMTPLADLC YPFHGPAQMK VGCDNTVVRM VSSGKHVNRV TFEYRQLEPY ELENPNGNSI GEFCLSGL

Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or GHRF) or somatocrinin, is a 44-amino acid peptide hormone produced in the arcuate nucleus of the hypothalamus. GHRH is released from neurosecretory nerve terminals of these arcuate neurons, and is carried by the hypothalamo-hypophysial portal circulation to the anterior pituitary gland where it stimulates growth hormone (GH) secretion. GHRH also stimulates the production of GH. GHRH is released in a pulsatile manner, stimulating similar pulsatile release of GH. In addition, GHRH also promotes slow-wave sleep directly. This synthetic Growth Hormone Releasing Hormone is a single, non-glycosylated, polypeptide of 29 amino acids and a molecular mass of 3358.9 Dalton. It corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone of 44 amino acids. The amino acid sequence is Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2. This GHRH peptide (1mg/mL) was lyophilized after extensive dialyses against 1.7mg sodium phosphate buffer (0.1mg sodium phosphate monobasic & 1.6mg sodium phosphate dibasic). Biological activity: GHRH increases plasma growth hormone concentrations by directly stimulating the anterior pituitary gland to release natural human growth hormone. Synonyms: Somatoliberin, Growth hormone-releasing factor, GRF, Growth hormone-releasing hormone, GHRH, Somatocrinin, Somatorelin, Sermorelin, GHRF, MGC119781.

Kanamycin is very stable as a solution in the pH range 6-8 and can be stored for 6-8 months at room temperature (with only 1-2% loss of activity). Autoclaving at 120°C (even for more than 1 hour) leads to only a slight loss of activity (5%). When exposed to air, Kanamycin may change colour but without losing much of its activity. The change in colour can be prevented by antioxidants. Aminoglycoside-antibiotic with broad antibacterial spectrum, (including mycobacteria, many gram-positive and most gram-negative organisms), Additive in culture media for the isolation of group D Streptococci on Kanamycin Esculin Azide Agar (Mossel et al.) or for selection of transformed plant cells containing the neomycin phosphotransferase (for kanamycin resistance), on a kanamycin-medium. Inhibits formation of peptide bonds, Cox d. et al. (1977) Sammes, P.G (ed.) Topics in antibiotics chemistry Vol. I, Chichester, Horwood, pp. 1-190, Lancini G., Parenti F. (1982) Antibiotics: Springer, New York, Pestka S. (1971) Annu. Rev. Microbiol. 25, 487-562.

Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs to stimulate GH release. GHRP-2, an investigational drug, is one of the most potent members of the GHRP family. It has been shown to be effective in adults via the oral and intranasal as well as the iv route of administration. Growth Hormone Releasing Peptide-2 Synthetic is a synthetic peptide including unnatural D-form amino acids (D-Ala-D-2-NAL-Ala-Trp-D-Phe-Lys). Synonyms: GHRP-2, GHRP.

Synonym: Adenosin, Adenosine, 9-β-D-Ribofuranosyladenine, Adenine riboside, Adenine-9-β-D-ribofuranoside, D-Adenosine

Recombinant murine GM-CSF produced in E.Coli is a single, non-glycosylated, polypeptide chain of 125 amino acids and a molecular mass of 14,285 Dalton. The ED50 as determined by the dose-dependant stimulation of the proliferation of murine FDC-P1 cell line is <0.2ng/mL, corresponding to a Specific Activity of 5,000,000 IU/mg. GMCSF is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. GM-CSF stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. Synonyms: CSF-2, MGI-1GM, GM-CSF, Pluripoietin-alpha, Molgramostin, Sargramostim. Synonyms: CSF-2, MGI-1GM, GM-CSF, Pluripoietin-alpha, Molgramostin, Sargramostim. Biological activity: The ED50 as determined by the dose-dependant stimulation of the proliferation of murine FDC-P1 cell line is <0.2ng/mL, corresponding to a Specific Activity of 5,000,000 IU/mg. Sequence: The sequence of the first five N-terminal amino acids is Met-Ala-Pro-Thr-Arg.

Description: Recombinant Human IL-15 produced in E.Coli is a single, non-glycosylated, polypeptide of 114 amino acids and a molecular mass of 12.8 kDa.  The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between IL-15 and IL-2. IL-15 induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported. Biological activity: The ED50 as determined by the dose-dependant stimulation of the proliferation of CTLL-2 was found to be <0.45ng/mL, corresponding to a Specific Activity of 3 x 106 IU/mg. Amino acid sequence: MNWVNVISDL KKIEDLIQSM HIDATLYTES DVHPSCKVTA MKCFLLELQV ISLESGDASI HDTVENLIIL ANNSLSSNGN VTESGCKECE ELEEKNIKEF LQSFVHIVQM FINTS  rec. human Interleukin-2; rec. Mouse Interleukin-2, rec. Rat Interleukin-2, rec. human Interleukin-7, rec. human Interleukin-15

Thidiazuron (TDZ) a urea derivative which acts as a cytokinin-active plant growth regulator used in micropropagations to supplement media such as Murashige and Skoog medium. TDZ promotes plant organogenesis (shoot regeneration) and plant regeneration. Thidiazuron (TDZ) enables the production of virus-free stock plants, speeds up breeding, and provides new genotypes for the market. Synonyms: 6-Furfurylaminopurine; N6-Furfuryladenine; Furfuryl(purin-6-yl)amine. Other active phytohormones are: Kinetin (C4304) >, Zeatin (C4301) > and 6-Benzylaminopurine (6-BAP). Antibiotics used in plant cell culture are: Rifampicin, Carbenicillin or Kanamycin sulfate (M3129) >.

Human GM-CSF produced in E.Coli is a single, non-glycosylated, polypeptide chain of 127 amino acids and a molecular mass of 14,477 Dalton. The ED50 as determined by the dose-dependant stimulation of the proliferation of human TF-1 cells (human erythroleukemic indicator cell line) is 0.1ng/mL, corresponding to a specific activity of 11 x 10E6 IU/mg. GM-CSF is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins IL-4 >, IL-5 >, and IL-13 >. GM-CSF stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. Synonyms: CSF-2, MGI-1GM, GM-CSF, Pluripoietin-alpha, Molgramostin, Sargramostim, MGC131935, MGC138897.

Porcine Luteinizing Hormone is a glycosylated, polypeptide chain which stimulates maturation of follicle, induces ovulation, accelerates formation of corpus luteum and secretion of pregnanolone. Porcine Luteinizing Hormone delays ovulation.

Aminoglycoside antibiotic that inhibits growth of procaryotic micro-organisms (bacteria), eukaryotic micro-organisms (yeast) and mammalian cells. Inhibits protein synthesis at translational step: causes misreading of mRNA. A gene from E.coli encoding resistance to hygromycin B can be isolated and cloned by recombinant DNA technology. It is useful for the identification or selection of recombinant clones in various cell types. The working concentration for mammalian cell selection is normally between 50µg/mL and 1mg/mL, plant cells: 20µg/mL-200µg/mL, bacteria: 20µg/mL-200µg/mL and Fungi: 200µg/mL - 1mg/mL. The appropriate concentration should be tested experimentally. Genaxxon bioscience offers a broad range of Antibiotics and Antimycotics > as powder or solutions, e.g., Geneticin G418 > or Kanamycin sulfate >.

Zeatin, a phytohormone derived from adenine, belongs to the family of plant growthhormones called cytokinins. Zeatin promotes growth of lateral buds, stimulates cell division, callus initiation and seed germination. Zeatin is used with Murashige & Skoog and other media to promote multiple shoot generation from internodes (promotion of growth of lateral buds giving bushier plants) and high frequency thick spread roots. Zeatin the active ingredient in coconut milk is not very stable in cell culture and therefor often replaced by the structurell related Kinetin (C4304) >. Both substances promote plant growth. Other active phytohormones are: Thidiazuron (TDZ) > and 6-Benzylaminopurine (6-BAP). Antibiotics used in plant cell culture are: Rifampicin, Carbenicillin or Kanamycin sulfate (M3129) >. Zeatin has several anti-aging effects on human skin fibroblasts.

IL10 is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Interleukin-10 is fully biologically active when compared to standard. The ED50 as determined by the dose-dependent co-stimulation (with murine IL-4) of MC/9 cells was found to be less than 2.0ng/mL, corresponding to a specific activity of 5.0×105 IU/mg. Amino acid composition: MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN.

Rec. human Leukemia Inhibitory Factor produced in E.Coli is a single, non-glycosylated, polypeptide of 181 amino acids with a molecular mass of 20kDa. Leukemia Inhibitory Factor (LIF) is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines and promotion of megakaryocyte productin on vivo. Human and mouse LIF show 78% identiy in the amino acid sequence. Human LIF is as active on human cells as it is on mouse cells, though mouse LIF is about 1000 fold less active on human cell, than human LIF.

Recombinant Rat IL-5

Interleukin-6 is a potent pro-inflammatory cytokine primarily produced by activated T cells and an assortment of other cells including endothelial cells and macrophages. IL-6 affects B and T lymphocytes and has been shown to have a role in host defense, acute phase reactions, immune responses and hematopoiesis. Rec. mouse Interleukin-6 produced in E.Coli is a single, non-glycosylated polypeptide chain of 187 amino acids and a molecular mass of 21709 Dalton. Synonyms: IFN-b2, B cell differentiation factor (BCDF), BSF-2, HPGF, HSF, MGI-2, IL-6, Interleukin HP-1, B-cell hybridoma growth factor.

Recombinant Rat Interleukin-6

Recombinant Murine Interleukin-7