rec. human Interleukin 13 (rHuIL-13)

Order number: C6261.0002
Shipping: shipped at RT, stored at -20°C Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.
*Prices plus VAT plus shipping costs
IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL13 is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene together with IL3 >, IL4 >, IL5 >, and CSF2 > forms a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.
Rec. human Interleukin-13 produced in E.Coli is a single, non-glycosylated polypeptide chain of 112 amino acids and a molecular mass of 12 kDa.
Amino acid sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIE VAQFVKDLLLHLKKLFREGRFN.
Synonyms: NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.
Technical Data:
Specifications:
Purity: min. 95% (HPLC and SDS-PAGE)
Lyophilized from a sterile filtered concentrated (1mg/mL) solution with 1xPBS pH7.2, 5% trehalose
Biological activity: The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be <1ng/mL, corresponding to a specific activity of >1 x 106units/mg.
Source
Escherichia ColiSicherheits Hinweise / Safety
Klassifizierungen / Classification
eclass-Nr: 32-16-04-90Dokumente - Protokolle - Downloads
Here you will find information and further literature on rec. human Interleukin 13 (rHuIL-13). For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.