rec. human Interleukin 13 (rHuIL-13)

Order number: C6261.0002
Shipping: shipped at RT, stored at -20°C Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.
Prices plus VAT plus shipping costs
IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL13 is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene together with IL3 >, IL4 >, IL5 >, and CSF2 > forms a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.
Rec. human Interleukin-13 produced in E.Coli is a single, non-glycosylated polypeptide chain of 112 amino acids and a molecular mass of 12 kDa.
Amino acid sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIE VAQFVKDLLLHLKKLFREGRFN.
Synonyms: NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.
Technical Data:
Specifications:
Purity: min. 95% (HPLC and SDS-PAGE)
Lyophilized from a sterile filtered concentrated (1mg/mL) solution with 1xPBS pH7.2, 5% trehalose
Biological activity: The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be <1ng/mL, corresponding to a specific activity of >1 x 106units/mg.
Source
Escherichia ColiSicherheits Hinweise / Safety
Klassifizierungen / Classification
eclass-Nr: 34-16-04-90Dokumente - Protokolle - Downloads
Here you will find information and further literature on rec. human Interleukin 13 (rHuIL-13). For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.