rec. Human Interleukin-10 (rHuIL-10)

rec. Human Interleukin-10 (rHuIL-10)


Order number: C6077.0002

Shipping: shipped at RT, stored at -20°C

Ready to ship today,
Delivery time 1-3 workdays

€194.93 *

Weight:

Please select the favoured pack size.

IL10 is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This... more
Product information "rec. Human Interleukin-10 (rHuIL-10)"

IL10 is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Interleukin-10 is fully biologically active when compared to standard. The ED50 as determined by the dose-dependent co-stimulation (with murine IL-4) of MC/9 cells was found to be less than 2.0ng/mL, corresponding to a specific activity of 5.0×105 IU/mg. Amino acid composition: MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN.

More products around "rec. Human Interleukin-10 (rHuIL-10)"
Purity: >97.0% (by RP-HPLC, IEX-HPLC, SDS-PAGE). Less than 1% dimers and aggregates. Sterile... more
 

Technical Data:

Purity: >97.0% (by RP-HPLC, IEX-HPLC, SDS-PAGE). Less than 1% dimers and aggregates. Sterile Filtered White lyophilized (freeze-dried) powder. The ED50 as determined by the dose-dependent co-stimulation (with murine IL-4) of MC/9 cells was found to

Source

CHO-cells

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads more

Dokumente - Protokolle - Downloads

Here you will find information and further literature on rec. Human Interleukin-10 (rHuIL-10). For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.

 
 
 
Read, write and discuss reviews... more
Customer evaluation for "rec. Human Interleukin-10 (rHuIL-10)"
Write an evaluation
Evaluations will be activated after verification.
Please enter these characters in the following text field.

The fields marked with * are required.