Order number: P2955.9505

Shipping: shipped at RT, store at -20°C

Ready to ship today,
Delivery time 1-3 workdays

Quantity Unit price
To 2 €300.00 *
From 3 €285.00 *


Please select the favoured pack size.


Please select the favoured purity.

LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense... more

LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria. Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution.

Amino acid sequence: [LL-37, 37 aa] (Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser)

Specifications: Purity: >95% (HPLC) Sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR... more

Technical Data:

Purity: >95% (HPLC)
MW = 4493.3 g/mol
Lyophilized white powder


LL-37 is used to study host defense mechanisms.



Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads more

Dokumente - Protokolle - Downloads

Here you will find information and further literature on human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: or phone: +49 731 3608 123.