Close filters
  •  
from to
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
No results were found for the filter!
Prod.Nr. Description     Price €
S5349.0100 Human ACE2 recombinant protein.(ECD, processed), Tag-free 
Recombinant human ACE2 protein (ECD. processed) Tag-free, liquid formulation. We offer high purity. and quality in HEK293 expressed recombinant protein for...
Peptides and Proteins 649,00
S5361.0100 human ACE2 Protein (ECD), Avi/His-Tag, biotinylated 
Recombinant human ACE2 protein (ECD. processed) contains an Avi/His tag and is biotinylated. We offer high purity. and quality in HEK293 expressed...
Peptides and Proteins 979,00
S5344.0100 recombinant human ACE2 Protein (ECD), Avi/His-Tag, non-biotinylated 
reombinant human ACE2 Protein (ECD. processed) contains an Avi/His-Tag, and is ready for invitro biotinylation, We offer high purity. and quality in HEK293...
Peptides and Proteins 649,00
S5340.0100 SARS-CoV-2 Spike S1 Protein (RBD) with His-Tag 
SARS-CoV-2 Spike Protein RBD Recombinant with C-terminal His-tag is a recombinant protein that is in liquid form buffered in PBS. This protein was produced...
Peptides and Proteins 345,00
C6003.0050 Coronavirus 2019 Nucleocapsid Mosaic Protein 
The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused...
Peptides and Proteins 225,00
S5341.0050 SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag...
Peptides and Proteins 995,00
S5342.0050 SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc...
Peptides and Proteins 995,00
S5343.0050 SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic - with His-Tag 
SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and...
Peptides and Proteins 225,00
S5346.0050 SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) 
SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (800-1000 a.a.)...
Peptides and Proteins 225,00
S5345.0050 SARS-CoV-2 Coronavirus 2019 Spike (300-600) RBD 
SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain is derived as a recombinant protein from E.Coli. The protein contains the Coronavirus...
Peptides and Proteins 225,00
S5347.0050 SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) 
SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.)...
Peptides and Proteins 225,00
S5348.0100 SARS-CoV-2 (COVID-19) Nucleocapsid protein - (1-419), His-Tag 
Beneath its envelope membrane, the new coronavirus SARS-CoV-2 consists of a icosaedric nucleocapsid that contains its genectic information in form of...
Peptides and Proteins 475,00
S5334.0100 SARS-CoV-2 Spike S1 Protein (RBD) - without Tag 
SARS-CoV-2 Spike Protein RBD Recombinant without His-tag is a recombinant protein that is in liquid form buffered in PBS. This protein was produced...
Peptides and Proteins 255,00
S5333.0100 SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilized Trimer 
The engineered recombinant Sars-Co-V-2 Spike S1 protein contains specific amino acid substitutions to stabilize the prefusion conformation (2P). Furthermore,...
Peptides and Proteins 528,00
C6018.0020 rec. Human Interferon-Gamma (rHulFN-g) 
Recombinant Human IFN-g produced in E.Coli is a single, non-glycosylated, polypeptide chain of 144 amino acids and amolecular mass of 16,879 Dalton....
Peptides and Proteins 145,00
P2299.9501 human LL-37 [LL-37, 37 aa] 
LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating...
Peptides and Proteins 174,25
1