Anti-infective peptides

Antimicrobial peptides (AMPs) offer a broad spectrum of antimicrobial activity against bacteria, viruses, and fungi.
They are evolutionarily conserved component of the innate immune response and are found amongst all life forms.
Among others, Genaxxon bioscience offers: 
α-Defensin 5; Histatin 5; Indolicidin; LL-37; Magainin-1; Pep27; Alamethicin; Omphalotin A; Gallidermin.

Antimicrobial peptides (AMPs) offer a broad spectrum of antimicrobial activity against bacteria, viruses, and fungi. They are evolutionarily conserved component of the innate immune response and... read more »
Close window
Anti-infective peptides

Antimicrobial peptides (AMPs) offer a broad spectrum of antimicrobial activity against bacteria, viruses, and fungi.
They are evolutionarily conserved component of the innate immune response and are found amongst all life forms.
Among others, Genaxxon bioscience offers: 
α-Defensin 5; Histatin 5; Indolicidin; LL-37; Magainin-1; Pep27; Alamethicin; Omphalotin A; Gallidermin.

Close filters
from to
No results were found for the filter!
Histatin 5 (peptide sequence: DSHAKRHHGYKRKFHEKHHSHRGY) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a broad spectrum antimicrobial activity against bacteria, viruses, and fungi. They are...
From €195.00 *
LL-37 human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
From €174.25 * €205.00 *
LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
From €174.25 * €205.00 *
Indolicidin (peptide sequence: ILPWKWPWWPWRR-NH2) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a broad spectrum antimicrobial activity against bacteria, viruses, and fungi. They are...
From €195.00 *
α-Defensin 5 human - ATCYCRTGRCATRESLSGVCEISGRLYRLCCR α-Defensin 5 human -...
α-Defensin 5 (peptide sequence: ATCYCRTGRCATRESLSGVCEISGRLYRLCCR) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a broad spectrum antimicrobial activity against bacteria, viruses, and fungi....
€675.00 *