Bioactive Proteins

bovine endothelial mitogen (ECGS) - Calmodulin - Natural mouse laminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin

bovine endothelial mitogen (ECGS) - Calmodulin - Natural mouse laminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin read more »
Close window
Bioactive Proteins

bovine endothelial mitogen (ECGS) - Calmodulin - Natural mouse laminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin

Close filters
from to
1 From 2
No results were found for the filter!
The DYKDDDDK peptide was developed specifically for immunoaffinity chromatography. The peptide allows the competitive elution of proteins (amino terminal, metaminoterminal or carboxy-terminal) FLAG® fusion proteins from anti-FLAG M1 or...
From €275.50 * €290.00 *
Albumin from egg - Ovalbumin
Albumin from egg - Ovalbumin
Albumin from chicken egg (Ovalbumin). Min. 98% protein. May be used as standard for molecular mass determination in PAGE.
From €209.23 *
Calmodulin, lyphilized
Calmodulin is a bioactive protein isolated from bovine testes with a molecular weight of 16,7 kDa. The material is derived from cattle born and raised in Sweden, a country where BSE is non-existing. Calmodulin is a calcium-binding...
From €110.17 *
Dermcidin, DCD-1...
Dermcidin-1L (DCD-1) is a 47-amino acid antimicrobial peptide (AMP). It is expressed in eccrine sweat glands, secreted into sweat at a concentration of 1-10µg/mL, and transported to the epidermal surface. Unlike most AMPs, which are...
From €375.95 *
Dermcidin, DCD-1L...
Dermcidin-1L (DCD-1L) is a 48-amino acid antimicrobial peptide (AMP) with a Leu residue on the C-terminus. It is expressed in eccrine sweat glands, secreted into sweat at a concentration of 1-10µg/mL, and transported to the epidermal...
From €375.95 *
bovine endothelial mitogen (ECGS)
bovine endothelial mitogen (ECGS)
Endothelial Mitogen can be used for Human & Mammalian Vascular Endothelial Cells at concentration of 0.1-0.3mg/mL of serum supplemented media & 0.01-0.1mg with heparin (Some primary cells require supplementation of 1-100µg/mL heparin)....
From €185.71 *
The DYKDDDDK peptide was specifically designed for immunoaffinity chromatography. It allows elution under mild and non-denaturing conditions. Several antibodies against this peptide have been developed. Usual working concentration is...
From €118.75 * €125.00 *
LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
From €285.00 * €300.00 *
LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
From €190.55 *
DYKDHDG-DYKDHDI-DYKDDDDK, a synthetic peptide was specifically designed for immunoaffinity chromatography. It allows elution under mild and non-denaturing conditions. Several antibodies against this peptide have been developed. The...
€386.25 *
Ovalbumin (crude)
Ovalbumin (crude)
Albumin from chicken egg (Ovalbumin). Crude: min. 80% protein.
From €57.45 *
rec. Human Serum Albumin (rHSA)
rec. Human Serum Albumin (rHSA)
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
From €262.32 *
1 From 2