Bioactive Proteins

bovine endothelial mitogen (ECGS) - Calmodulin - Natural mouse laminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin

bovine endothelial mitogen (ECGS) - Calmodulin - Natural mouse laminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin read more »
Close window
Bioactive Proteins

bovine endothelial mitogen (ECGS) - Calmodulin - Natural mouse laminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin

Close filters
from to
No results were found for the filter!
The DYKDDDDK peptide was developed specifically for immunoaffinity chromatography. The peptide allows the competitive elution of proteins (amino terminal, metaminoterminal or carboxy-terminal) FLAG® fusion proteins from anti-FLAG M1 or...
From €283.77 * €290.00 *
Albumin from egg - Ovalbumin
Albumin from egg - Ovalbumin
Albumin from chicken egg (Ovalbumin). Min. 98% protein. May be used as standard for molecular mass determination in PAGE.
From €215.51 *
Bovine albumin acetylated, molecular biology grade
Bovine albumin acetylated, molecular biology grade
The manufacturing process uses acetic anhydride and chaotropic agents which destroy nucleases and proteases commonly found in BSA. Genaxxon bioscience acetylated albumin is thus specially recommended for all molecular biology applications.
From €140.30 *
Bovine albumin crystallized, free of fatty acid, free of globulin
Bovine albumin crystallized, free of fatty...
Albumin - crystallised is a Fraction V Albumin recrystallised 3 times at temperatures below 0°C. This procedure ensures a very native protein, that is free of carbohydrates, globulines and fatty-acids.
From €101.33 *
Bovine albumin for EIA and RIA
Bovine albumin for EIA and RIA
Kompatibel mit vielen diagnostischen Enzymen und Komponenten. Hauptsächlich monomeres Albumin. IgGs nicht detektierbar.
From €67.54 *
Bovine albumin Fraction V (pH 7.0)
Bovine albumin Fraction V (pH 7.0)
Standard grade, lyophilised Albumin. Bovine serum albumin (BSA) is added as a stabilizing component for proteins/enzymes to several enzyme reaction and storage buffers. The concentration usually ranges from 0.01% (0.1mg/mL) to 3%...
From €65.03 *
bovine endothelial mitogen (ECGS)
bovine endothelial mitogen (ECGS)
Endothelial Mitogen can be used for Human & Mammalian Vascular Endothelial Cells at concentration of 0.1-0.3mg/mL of serum supplemented media & 0.01-0.1mg with heparin (Some primary cells require supplementation of 1-100µg/mL heparin)....
From €191.28 *
Bovine serum albumin - Microbiology grade
Bovine serum albumin - Microbiology grade
Special quality for microbiology. Especially suited e.g. Mycobacteria, Trypanosoma, Mycoplasma, etc.. Manufactured by a proprietary heat-shock fractionation process; double heated to insure inactivation of proteolytic activity. Excellent...
From €56.04 *
Bovine Serum Albumin, very low endotoxin, no IgG
Bovine Serum Albumin, very low endotoxin, no IgG
Heat treated (equivalent to 10 hours at 60°C). IgG not detectable. Free of mycoplasma and bovine viruses. Free from capryllic acid or other stabilisers that could be cytotoxic to some cell lines. Tested for use in tissue culture.
From €77.25 *
Calmodulin, lyphilized
Calmodulin is a bioactive protein isolated from bovine testes with a molecular weight of 16,7 kDa. The material is derived from cattle born and raised in Sweden, a country where BSE is non-existing. Calmodulin is a calcium-binding...
From €113.48 *
Dermcidin - DCD-1...
Dermcidin-1L (DCD-1) is a 47-amino acid antimicrobial peptide (AMP). It is expressed in eccrine sweat glands, secreted into sweat at a concentration of 1-10µg/mL, and transported to the epidermal surface. Unlike most AMPs, which are...
From €387.23 *
Dermcidin - DCD-1L...
Dermcidin-1L (DCD-1L) is a 48-amino acid antimicrobial peptide (AMP) with a Leu residue on the C-terminus. It is expressed in eccrine sweat glands, secreted into sweat at a concentration of 1-10µg/mL, and transported to the epidermal...
From €387.23 *
LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
From €285.00 * €300.00 *
LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
From €196.27 *
The DYKDDDDK peptide was specifically designed for immunoaffinity chromatography. It allows elution under mild and non-denaturing conditions. Several antibodies against this peptide have been developed. Usual working concentration is...
From €118.75 * €125.00 *
DYKDHDG-DYKDHDI-DYKDDDDK, a synthetic peptide was specifically designed for immunoaffinity chromatography. It allows elution under mild and non-denaturing conditions. Several antibodies against this peptide have been developed. The...
€397.84 *
Ovalbumin (crude)
Ovalbumin (crude)
Albumin from chicken egg (Ovalbumin). Crude: min. 80% protein.
From €59.17 *
rec. Human Serum Albumin (rHSA)
rec. Human Serum Albumin (rHSA)
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
From €270.19 *