No results were found for the filter!
3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK The DYKDDDDK peptide was developed specifically for immunoaffinity chromatography. The peptide allows the competitive elution of proteins (amino terminal, metaminoterminal or carboxy-terminal) FLAG® fusion proteins from anti-FLAG M1 or...
From €238.96 * €298.70 *
Albumin from hen egg white - Ovalbumin Albumin from hen egg white (ovalbumin) is a phosphorylated glycoprotein that contains 385 amino acid residues and has a molecular weight of 42.7 kDa. Chicken egg white is the protein component with the highest amount of egg white. It is...
From €226.29 *
Bovine albumin acetylated, molecular biology grade The manufacturing process uses acetic anhydride and chaotropic agents which destroy nucleases and proteases commonly found in BSA. Genaxxon bioscience acetylated albumin is thus specially recommended for all molecular biology applications.
From €151.74 *
Bovine albumin crystallized, free of fatty... Albumin - crystallised is a Fraction V Albumin recrystallised 3 times at temperatures below 0°C. This procedure ensures a very native protein, that is free of carbohydrates, globulines and fatty-acids.
From €109.59 *
Bovine albumin for EIA and RIA IgG-free bovine serum albumin. Especially recommended as a blocking and stabilising reagent in all antibody-mediated detection systems. In addition to being IgG-free, this albumin also shows a very low fatty acid content of less than...
From €59.75 *
Bovine albumin Fraction V (pH 7.0) Standard grade, lyophilised Albumin. Bovine serum albumin (BSA) is added as a stabilizing component for proteins/enzymes to several enzyme reaction and storage buffers. The concentration usually ranges from 0.01% (0.1mg/mL) to 3%...
From €71.00 *
Bovine Serum Albumin, very low endotoxin, no IgG Heat treated (equivalent to 10 hours at 60°C). IgG not detectable. Free of mycoplasma and bovine viruses. Free from capryllic acid or other stabilisers that could be cytotoxic to some cell lines. Tested for use in tissue culture.
From €83.54 *
Calmodulin, lyphilized Calmodulin is a bioactive protein isolated from bovine testes with a molecular weight of 16,7 kDa. The material is derived from cattle born and raised in Sweden, a country where BSE is non-existing. Calmodulin is a calcium-binding...
From €122.72 *
Dermcidin - DCD-1... Dermcidin-1L (DCD-1) is a 47-amino acid antimicrobial peptide (AMP). It is expressed in eccrine sweat glands, secreted into sweat at a concentration of 1-10µg/mL, and transported to the epidermal surface. Unlike most AMPs, which are...
From €850.00 *
Dermcidin - DCD-1L... Dermcidin-1L (DCD-1L) is a 48-amino acid antimicrobial peptide (AMP) with a Leu residue on the C-terminus. It is expressed in eccrine sweat glands, secreted into sweat at a concentration of 1-10µg/mL, and transported to the epidermal...
From €925.00 *
FLAG-Peptide - DYKDDDDK The DYKDDDDK peptide was specifically designed for immunoaffinity chromatography. It allows elution under mild and non-denaturing conditions. Several antibodies against this peptide have been developed. Usual working concentration is...
From €140.00 * €175.00 *
human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR LL-37 human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
From €241.40 * €284.00 *
human LL-37 [LL-37, 37 aa] LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
From €245.14 * €306.43 *
rec. Human Serum Albumin (rHSA) Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
From €566.50 *
rec. Human Serum Albumin (rHSA) - from rice grain Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
From €371.00 *
rec. Human Serum Albumin (rHSA) - lipid-free Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
From €242.05 *