No results were found for the filter!
![[beta]-Amyloid (10-20) - YEVHHQKLVFF [beta]-Amyloid (10-20) - YEVHHQKLVFF](/themes/Frontend/Responsive/frontend/_public/src/img/no-picture.jpg)
[beta]-Amyloid (10-20) (peptide sequence: YEVHHQKLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-42 peptide. Amyloid-beta (1-42) human is an Alzheimer desease peptide. Characteristic of Alzheimer...
€242.05 *
![[beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS [beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS](/themes/Frontend/Responsive/frontend/_public/src/img/no-picture.jpg)
Amino acid sequence RERMS represents the active domain of amyloid beta/A4 protein precursor that promotes fibroblast growth; H. Ninomiya, et al.; J. Cell. Biol. 121, 879 (1993). The characteristic of Alzheimer disease is the accumulation...
€100.26 *

Ac-KLVFF-NH2 is the N-terminal and C-terminal modified form of the amyloid-beta (16-20) inhibitor peptid KLVFF. The modification leads to higher stability against peptidases. The KLVFF peptide is one of several inhibitors of amyloid-beta...
From €158.70 *

Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly....
From €418.40 *

[beta]-Amyloid (1-40), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are...
From €272.92 *

[beta]-Amyloid (1-40), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are...
From €418.40 *

[beta]-Amyloid (1-40), human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques...
From €253.11 *

[beta]-Amyloid (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques...
From €687.86 * €724.07 *

[beta]-Amyloid (16-20) - KLVFF (peptide sequence: KLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-40 peptide. The KLVFF peptide is one of several inhibitors of amyloid-beta aggregation that have...
€100.26 *

Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ. Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by...
From €218.04 *

Biotinylated amyloid-ß-(1-40) peptide. Biotinylated peptides are a useful tool in many important applications. Biotin has a strong affinity for avidin or streptavidin. This interaction can be used for qualitative and quantitative...
From €495.24 *

Biotinylated amyloid-ß (1-40) peptide from rat. Biotinylated peptides are a useful tool in many important applications. Biotin has a strong affinity for avidin or streptavidin. This interaction can be used for qualitative and...
From €495.24 *

Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly....
From €253.11 *

Control peptide Amyloid-beta (40-1) rat. Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble...
From €253.11 *

The DWGKGGRWRLWPGASGKTEA peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by...
From €218.00 *

Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
From €207.66 *

Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
From €158.70 *
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
From €158.70 *

Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
From €207.66 *

RIIGL is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches....
From €158.44 *