hGHRP-2 / Human Growth Hormone Releasing Peptide-2

hGHRP-2 / Human Growth Hormone Releasing Peptide-2


Order number: C6471.0025

Shipping: shipped at RT, stored at -20°C

Ready to ship today,
Delivery time 1-3 workdays

€238.70 *

Weight:

Please select the favoured pack size.

Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides... more
Product information "hGHRP-2 / Human Growth Hormone Releasing Peptide-2"

Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs to stimulate GH release. GHRP-2, an investigational drug, is one of the most potent members of the GHRP family. It has been shown to be effective in adults via the oral and intranasal as well as the iv route of administration.

Growth Hormone Releasing Peptide-2 Synthetic is a synthetic peptide including unnatural D-form amino acids (D-Ala-D-2-NAL-Ala-Trp-D-Phe-Lys).

Synonyms: GHRP-2, GHRP.

More products around "hGHRP-2 / Human Growth Hormone Releasing Peptide-2"
Purity: >98.0% (RP-HPLC). Sequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2; MW = 817.9 g/mol. more
 

Technical Data:

Purity: >98.0% (RP-HPLC). Sequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2; MW = 817.9 g/mol.

Source

chemical synthesis

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads more

Dokumente - Protokolle - Downloads

Here you will find information and further literature on hGHRP-2 / Human Growth Hormone Releasing Peptide-2. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.

 
 
 
Read, write and discuss reviews... more
Customer evaluation for "hGHRP-2 / Human Growth Hormone Releasing Peptide-2"
Write an evaluation
Evaluations will be activated after verification.
Please enter these characters in the following text field.

The fields marked with * are required.

human growth hormon releasing factor 6 [D-Lys3]-GHRP-6
From €115.88 * €125.00 *
ACTH (1-10), human SYSMEHFRWG ACTH (1-10), human SYSMEHFRWG
From €85.50 * €90.00 *
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39), human...
From €441.75 * €465.00 *