Für die Filterung wurden keine Ergebnisse gefunden!
Prod.Nr. | Description | Price € | ||
---|---|---|---|---|
P2251.0001 | Kontrollpeptid Amyloid-beta (40-1) Ratte Kontrollpeptid Amyloid-beta (40-1) von Ratte. Charakteristisch für die Alzheimer-Krankheit ist die Anreicherung von Amyloid-Plaques im Gehirn. Die... | 260,71 | ||
P2252.0001 | Kontrollpeptid Amyloid-beta (40-1) human Kontrollpeptid Amyloid-beta (40-1). Charakteristisch für die Alzheimer-Krankheit ist die Anreicherung von Amyloid-Plaques im Gehirn. Die Hauptkomponenten... | 260,71 | ||
P2261.7005 | FYLKVPSSLHHHHGRDKLVFFHHHH Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta... | 213,89 | ||
P2262.7005 | Peptid: NYSKMIFSHHHH Das Peptid: NYSKMIFSHHHH ist einer von verschiedenen publizierten Inhibitoren der amyloid-beta Aggregation. Viele dieser Inhibitoren sind Fragmente und/oder... | 163,46 | ||
C4264.0025 | Trypsin aus Schweinepankreas (1:250) Trypsin 1:250 aus Rinderpankreas. Trypsin spaltet Peptide auf der C-terminalen Seite von Lysin- und Argininresten. Die Geschwindigkeit der Hydrolyse dieser... | 128,87 | ||
C4255.0100 | Collagenase Typ I (EC 3.4.24.3) >100 units/mg Collagenase aus Clostridium histolyticum lyophilisiert (>90 Mandl-Einheiten / >90 CDU-Einheiten). Histolyticum clostridiopeptidase (EC 3.4.24.3). Natürliches... | 85,62 | ||
C4341.0100 | Collagenase Typ II (EC 3.4.24.3) >180 units/mg Collagenase aus Clostridium histolyticum lyophilisiert (>180 Mandl-Einheiten / >180 CDU-Einheiten). Histolyticum clostridiopeptidase (EC 3.4.24.3). Genaxxon... | 86,32 | ||
C4346.2000 | Collagenase Typ III (EC 3.4.24.3) Collagenase aus Clostridium histolyticum lyophilisiert (125 bis 250 Mandl-Einheiten). Histolyticum clostridiopeptidase (EC 3.4.24.3). Typ III Collagenase aus... | 1405,69 | ||
C4310.0100 | Collagenase Typ IV (EC 3.4.24.3) >900 units/mg Collagenase aus Clostridium histolyticum lyophilisiert (>900 Mandl-Einheiten/mg / >900 CDU-Einheiten/mg). Histolyticum clostridiopeptidase (EC 3.4.24.3).... | 108,47 | ||
C6471.0025 | hGHRP-2 / Human Growth Hormone Releasing Peptide-2 Humanes Wachstumshormon freisetzendes Peptid 2. Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH... | 140,69 | ||
C6499.0100 | rhuPTH - rekombinantes humanes Parathyroidhormon (aa 1-34) Parathyroid hormone (PTH), or parathormone, is secreted by the parathyroid glands as a polypeptide of 84 amino acids. It acts to increase the concentration... | 318,80 | ||
S5557.0100 | rHu HER2-ECD / humanes ErbB2/Her2 Herstatin Die Proteine dieser Gruppe (ErbB1-4) dienen als Rezeptoren der Epidermal growth Faktoren. ErbB2 wird auf der Oberfläche von Epithelzellen und stark... | 618,33 | ||
S5558.0100 | rHu EpCAM - 100 µg Das Epithelial Cell Adhesion Molekül (EpCAM), auch bekannt als Antigen GA733-2 ist ein 40 kDa Transmembranglycoprotein. Es besteht aus einer 242... | 525,00 | ||
M3100.0005 | Rinderserumalbumin (BSA) - Fettsäurefrei Kristallisiertes Albumin ist die reinste Form der Genaxxon Rinderalbumine. Das Produkt enthält keine Rückstände des Kristallisationsagenz oder anderer... | 112,88 | ||
M3103.0025 | Rinderserumalbumin (BSA) Fraction V (pH 7,0) Lyphilisiertes Albumin (Standardreinheit). Serumalbumin vom Rind (BSA) wird häufig zur Stabilisierung von Proteinen den entsprechenden Puffern zugesetzt. Die... | 73,13 | ||
M3105.0005 | Albumin aus Hühnereiweiss - Ovalbumin Albumin aus Hühnereiweiß (Ovalbumin). Wird in der Proteinforschung zur Molmassenmessung und der Strukturaufklärung verwendet. Es dient auch als... | 226,29 | ||
M3177.0250 | Ovalbumin (Rohextrakt) Albumin aus Hühnerei (Ovalbumin). Rohextrakt: mind. 80% Proteingehalt. | 79,57 | ||
M6384.0010 | rek. humanes Serumalbumin (rHSA) - Lipidfrei Synonyme: Serum albumin, ALB, PRO0883, PRO0903, PRO1341, DKFZp779N1935, GIG20, GIG42, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696, SA, HSA. | 249,31 | ||
S5228.0001 | alpha-Chymotrypsin (EC 3.4.21.1) Activität: min. 1000 E/mg, alpha-Chymotrypsin ist eine Serinprotease die Peptidbindungen mit aromatischen oder großen hydrophoben Seitenketten (Tyr, Trp,... | 71,15 | ||
S5053.0001 | Molbio Grade Lysozym aus Hühnereiweiß, min. 20.000 U/mg Lysozym hydrolysiert bevorzugt die β-1,4-glykosidische Bindung zwischen N-Acetylmuraminsäure und N-Acetyl-D-glucosamin, Bestandteile der... | 45,32 | ||
S5239.0100 | Pankreatin Pankreatin ist ein enzymatisch komplexes Gemisch von Wirkstoffen die aus der Bauchspeicheldrüse von Hausschweinen gewonnen werden. | 49,97 | ||
S5240.0025 | Papain Papain gehört zu den proteolytischen Enzymen, die eine freie Sulfhydryl-Gruppe für die Aktivität brauchen (Gruppe der Cystein-Proteasen). Das pH-Optimum von... | 67,00 | ||
S5241.0025 | Pepsin (EC 3.4.23.1) Pepsin aus Schweinemagen. Seine inaktive Vorstufe ist das von den Hauptzellen der Magenschleimhaut sezernierte Pepsinogen. Pepsinogen wird bei einem sauren... | 53,79 | ||
S5366.1000 | TEV Protease - aus Tobacco Etch Virus TEV-Protease ist eine hochspezifische Cysteinprotease aus dem Tobacco Etch Virus (TEV). Aufgrund ihrer hohen Sequenzabhängigkeit ist die TEV-Protease... | 179,93 | ||
S5367.1100 | Serratia Nuclease - 100000 IU Serratia nuclease is a non-specific enzyme that cleaves all forms of DNA and RNA very efficiently. It is commonly used on biological material for the... | 656,84 | ||
S5197.0500 | rek. L-Asparaginase L-Asparaginase. L-Asparaginase is an enzyme that depletes L-Asparagine an important nutrient for cancer cells resulting in cancer/tumor cell starvation.... | 201,96 | ||
S5201.0001 | recombinantes Lysostaphin - EC 3.4.24.75 Lysostaphin, eine spezifische Endopeptidase für Zellwandpeptidoglycane von Staphylococci, ist ein extrem potentes anti-Staphylococcus Reagenz. Lysostaphin... | 180,25 | ||
M3101.0050 | Rinderalbumin für EIA und RIA Verwendbar mit verschiedenen diagnostischen Enzymen und Komponenten. Primär monomeres Albumin. IgG nicht nachweisbar. | 61,54 | ||
M6077.0005 | Trypsin aus Rinderpankreas Trypsin aus Rinderpankreas. Trypsingehalt (BAEE): min. 2500 U/mg. Lyophilisiert. Kein P. aeruginosa, Salmonella, Staphyloccus aureus nachweisbar. Synonym:... | 358,00 | ||
S5230.0005 | Chymotrypsinogen A Chymotrypsinogen ist der praktisch inakive "Precursor" (Proenzym, oder auch Zymogen) von Chymotrypsin. Um aktiviert zu werden, muss Chymotrypsinogen zwischen... | 407,31 | ||
P2292.9501 | CyLoP-1 Peptid CRWRWKCCKK CPPs, wie CyloP-1, werden im Allgemeinen von endozytotischen Pfaden aufgenommen, und die vesikuläre Verkapselung ist ein limitierender Faktor im Bereich des... | 144,00 | ||
P2291.9505 | Antennapedia (43-58) penetratin Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie... | 206,00 | ||
P2289.9501 | D-TAT (47-57) ygrkkrrqrrr-NH2 Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie... | 296,13 | ||
P2287.9501 | Nona-D-Arginin / D-Arg9 (r9) Nona-D-Arginin (r9, bzw. Sequenz: rrrrrrrrr) gehört zur Gruppe der zellpenetrierenden Peptiden (CPPs), die durch ihre Fähigkeit gekennzeichnet, die... | 311,25 | ||
P2273.9501 | PLP (139-151) HCLGKWLGHPDKF PLP (139 - 151) - HCLGKWLGHPDKF repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind... | 160,68 | ||
P2274.9501 | PLP (178-191) NTWTTCQSIAFPSK PLP (178-191) - NTWTTCQSIAFPSK repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Solche Proteine sind offensichtlich Ziele der... | 148,00 | ||
P2266.9501 | MOG (35-55) Human MEVGWYRPPFSRVVHLYRNGK Das MOG Peptidfragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) induziert in wissenschaftlichen Experimenten eine autoimmune... | 178,23 | ||
P2268.9505 | MOG (97-108) TCFFRDHSYQEE MOG (97-108) TCFFRDHSYQEE repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich... | 168,00 | ||
P2257.7005 | RIIGL - Inhibitorpeptid von Amyloid-beta RIIGL is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the... | 163,20 | ||
P2255.9505 | Amyloid-beta (16-20) KLVFF Inhibitorpeptid von Amyloid-beta The KLVFF peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived... | 103,27 | ||
P2259.7005 | Amyloid-beta Peptid PGRSPFTGKKLFNQEFSQDQ Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta... | 224,58 | ||
P2258.7005 | DWGKGGRWRLWPGASGKTEA - Inhibitorpeptid von Amyloid-beta DWGKGGRWRLWPGASGKTEA peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified... | 224,54 | ||
P2256.7005 | Ac-KLVFF-NH2 Ac-KLVFF-NH2 is the N-terminal and C-terminal modified form of the amyloid-beta (16-20) inhibitor peptid KLVFF. The modification leads to higher stability... | 163,46 | ||
C6470.1000 | Growth-hormone-releasing hormone (GHRH) Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or GHRF) or somatocrinin, is a 44-amino acid peptide hormone... | 174,45 | ||
P2285.9501 | EBV EBNA-3A (379-387) HLA-B*07:02 RPPIFIRRL Single peptide (RPPIFIRRL) for stimulation of human EBV EBNA-3A (379-387) -specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC... | 116,00 | ||
C6453.0005 | Antide Acetate Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s body to represses FSH and LH releases that stem from the... | 192,33 | ||
C4352.0001 | Zymolyase(R)-20T Zymolyase®, produced by a submerged culture of Arthrobacter luteus, has strong lytic activity against living yeast cell walls to produce protoplast or... | 297,41 | ||
C4366.0500 | Zymolyase(R)-100T Zymolyase®, produced by a submerged culture of Arthrobacter luteus, has strong lytic activity against living yeast cell walls to produce protoplast or... | 802,15 | ||
C6472.0005 | GHRP-6 HwAWfK-NH2 Wachstumshormon freisetzendes Peptid 6 ist ein synthetisches Peptid das, genau wie GHRH direkt auf somatotrophe Zellen der Hypophyse wirkt und zur... | 122,94 | ||
C6461.0010 | rhCG - Corticotropin releasing hormone binding protein CRH is a powerful stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. CRH concentration in the human peripheral circulation is... | 140,69 | ||
S5233.0001 | Hyaluronidase (EC 3.2.1.35) - min. 500 U/mg Hyaluronidase isoliert aus Schafshoden. Tierische glykolytische Hyaluronidase (EC 3.2.1.35) katalysisert die Hydrolyse von 1-4 Bindungen zwischen... | 262,65 | ||
P2283.9501 | Ova (323-339) ISQAVHAAHAEINEAGR Ova (323-339) - T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der... | 148,53 | ||
P2304.9505 | [beta]-Amyloid (10-20) - YEVHHQKLVFF Biotinylated amyloid-ß-peptides: Biotinylated peptides are a useful tool in many important applications. Biotin has a strong affinity for avidin or... | 249,31 | ||
P2305.9501 | α-Defensin 5 human - ATCYCRTGRCATRESLSGVCEISGRLYRLCCR α-Defensin 5 (Peptidsequenz: ATCYCRTGRCATRESLSGVCEISGRLYRLCCR) gehört zur Gruppe der antimikrobiell wirksamen Peptide (antimicrobial peptides = AMPs), die... | 720,00 | ||
P2306.9501 | Histatin 5: DSHAKRHHGYKRKFHEKHHSHRGY Histatin 5 (Peptidsequenz: DSHAKRHHGYKRKFHEKHHSHRGY) gehört zur Gruppe der antimikrobiell wirksamen Peptide (antimicrobial peptides = AMPs), die ein breites... | 225,00 | ||
P2307.9501 | Indolicidin - ILPWKWPWWPWRR-NH2 Indolicidin (Peptidsequenz: ILPWKWPWWPWRR-NH2) gehört zur Gruppe der antimikrobiell wirksamen Peptide (antimicrobial peptides = AMPs), die ein breites... | 235,00 | ||
P2302.7005 | Nona-D-Arginin / D-Arg9 (r9) - amidierter C-terminus Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie... | 287,79 | ||
P2308.7005 | Nona-D-Arginin / D-Arg9 (r9) - modifizierte Enden Nona-D-Arginin (r9, bzw. Sequenz: rrrrrrrrr) gehört zur Gruppe der zellpenetrierenden Peptiden (CPPs), die durch ihre Fähigkeit gekennzeichnet, die... | 287,79 | ||
P3286.9505 | Ova (257-264) SIINFEKL amide Ovalbumin (257-264) chicken has been used to trigger T cell activation in immunology studies. Ova (257-264) - SIINFEKL gehört zu den T-Zell-Epitop-Peptiden.... | 116,00 | ||
P3287.9505 | Ova (323-339) ISQAVHAAHAEINEAGR-NH2 (Amid) Ova (323-339) - T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der... | 111,24 | ||
P2799.9505 | HCV NS3 (1406-1415) (HLA-A*02:01) KLSGLGINAV | 108,75 | ||
P2706.9505 | EBV EBNA-1 (407-417) HLA-B*35:01 HPVGEADYFEY | 76,00 | ||
P3094.9505 | p53 (264-272) HLA-A*0201 LLGRNSFEV | 108,75 | ||
P2655.9505 | CD20 188-196 (HLA-A*02:01) HLA-A*02:01 SLFLGILSV | 85,50 | ||
P2659.9505 | CD22-4 (371-379) HLA-A*02:01 RLLGKESQL | 85,50 | ||
P2751.9505 | gp100 (154-162) HLA-A*02:01 KTWGQYWQV gp100 (154-162) HLA-A*02:01 KTWGQYWQV ist ein lineares Peptid-Epitop (Epitop ID 33915), das als Teil des Melanozytenproteins PMEL von Homo sapiens (human)... | 116,00 | ||
P3118.9505 | PRAME (100-108) HLA-A*0201 VLDGLDVLL PRAME (100-108) HLA-A*0201 VLDGLDVLL zur Stimulation humaner Prame (100-108) spezifischer CD8+ T-Zellen. Das Peptid wurde so synthetisiert, wie es von... | 108,75 | ||
P3120.9505 | PRAME (301-309) HLA-A24 LYVDSLFFL | 108,75 | ||
P2910.9505 | CMV IE-1 (99-107) RIKEHMLKK IE-1 steht für immediate-early protein 1. CMV für human cytomgealovirus, bzw. HCMV für human cytomegalovirus oder auch HPV Human herpesvirus. | 76,00 | ||
P3175.9505 | Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV zur Stimulation von T-Zellen. Das Einzelpeptid (YMDGTMSQV) wird zur Stimulation von humanen... | 108,75 | ||
P2674.9505 | CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von MHC-Klasse-I-Molekülen präsentiert wird.... | 85,50 | ||
P3176.9505 | Tyrosinase (425-434) HLA-A*03:01 YMVPFIPLYR Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV zur Stimulation von T-Zellen. Das Einzelpeptid (YMDGTMSQV) wird zur Stimulation von humanen... | 108,75 | ||
P2815.9505 | HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL. HER2 ist die Abkürzung für die englische Bezeichnung „human epidermal growth factor receptor 2“. HER2 wird... | 72,00 | ||
P2526.9505 | [Phe17] Apelin KFRRQRPRLSHKGPMPF Apelin (auch als APLN bekannt) ist ein Peptid, das beim Menschen vom APLN-Gen kodiert wird. Es ist in verschiedenen Organen wie Herz, Lunge, Niere, Leber,... | 226,10 | ||
P3139.9505 | RHAMM (165-173) HLA-A*0201 ILSLELMKL RHAMM (165-173) HLA-A*0201 ILSLELMKL zur Stimulation von humanen RHAMM-spezifischen CD8+ T-Zellen. Das Peptid wird so synthetisiert, wie es durch das Allel... | 108,75 | ||
P3144.9505 | SART3 (309-317) HLA-A*02:01 RLAEYQAYI | 108,75 | ||
P3143.9505 | RSV NP (137-145) HLA-A*02:01 KMLKEMGEV RSV NP (137-145) HLA-A*02:01 KMLKEMGEV ist ein lineares peptidisches Epitop (Epitop ID32357), das als Teil von Nucleoprotein aus dem humanen respiratorischen... | 108,75 | ||
P2695.9505 | EBV BMRF1 (208-216) HLA-A*02:01 TLDYKPLSV CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von MHC-Klasse-I-Molekülen präsentiert wird.... | 72,00 | ||
P2709.9505 | EBV EBNA-3A (325-333) HLA-B*08:01 FLRGRAYGL | 76,00 | ||
P2723.9505 | EBV LMP2 (131-139) HLA-A*24:02 PYLFWLAAI | 76,00 | ||
P2837.9505 | HIV Gag (50-59) HLA-A*02:01 SLFNTVATLY HIV Gag (50-59) HLA-A*02:01 SLFNTVATLY gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen... | 72,00 | ||
P2838.9505 | HIV-1 Gag (77-85) HLA-A*02:01 SLFNTVATL HIV-1 Gag (77-85) HLA-A*02:01 SLFNTVATL gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen... | 72,00 | ||
P2424.9505 | Amyloid-beta (1-42). Ratte DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA [beta]-Amyloid (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the... | 708,50 | ||
P3025.9505 | MOG (35-55) Ratte/Maus MEVGWYRSPFSRVVHLYRNGK - Acetat Das MOG Peptidfragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment) induziert eine autoimmune Encephalomyelitis bei Nagetieren ähnlich MS. | 374,63 | ||
P2267.9501 | MOG (92-106) DEGGYTCFFRDHSYQ MOG (92-106) DEGGYTCFFRDHSYQ repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich... | 168,00 | ||
P2598.9505 | ACTH (1-10). human SYSMEHFRWG ACTH (1-10), human SYSMEHFRWG ist ein synthetisches Peptid entsprechend den ersten 10 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der Name schon... | 72,00 | ||
P2612.9505 | ACTH (1-39). human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ist ein synthetisches Peptid entsprechend den ersten 39 Aminosäuren des humanen... | 441,75 | ||
P2603.9505 | ACTH (18-39). human RPVKVYPNGAEDESAEAFPLEF ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF ist ein synthetisches Peptid entsprechend den Aminosäuren 18 bis 39 des humanen ACTH/Adrenocorticotropin. Wie der... | 261,25 | ||
P2607.9505 | ACTH (4-10). human MEHFRWG ACTH (4-10), human MEHFRWG ist ein synthetisches Peptid entsprechend den Aminosäuren 4 bis 10 des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt,... | 85,50 | ||
P2470.9505 | [Des-octanoyl]-Ghrelin. human GSSFLSPEHQRVQQRKESKKPPAKLQPR Ghrelin ist ein Peptidhormon, bestehend aus 28 Aminosäuren. Die dritte Aminosäure Serin des Ghrelins ist mit Octansäure verestert. Diese Modifikation ist... | 318,25 | ||
P2471.9505 | [Des-octanoyl]-Ghrelin. rat GSSFLSPEHQKAQQRKESKKPPAKLQPR Ghrelin ist ein Peptidhormon, bestehend aus 28 Aminosäuren. Die dritte Aminosäure Serin des Ghrelins ist mit Octansäure verestert. Diese Modifikation ist... | 318,25 | ||
P2909.9505 | CMV IE-1 (316-324) (I1) HLA-A*02:01 ILEETSVML CMV IE-1 (316-324) (I1) HLA-A*0201 ILEETSVML zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von MHC-Klasse-I-Molekülen präsentiert... | 76,00 | ||
P2813.9505 | HER-2/neu (434-443) HLA-A*02:01 ILHDGAYSL HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL. HER2 ist die Abkürzung für die englische Bezeichnung „human epidermal growth factor receptor 2“. HER2 wird... | 108,75 | ||
P2965.9505 | MAGE-A3 (112-120) HLA-A*02:01 KVAELVHFL MAGE-A3 (112-120) HLA-A*02:01 KVAELVHFL gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen... | 76,00 | ||
P2966.9505 | MAGE-A3 (112-120) HLA-A*02:01 KVAEELVHFL - alternative sequence MAGE-A3 (112-120) HLA-A*02:01 KVAEELVHFL gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen... | 80,63 | ||
P2969.9505 | MAGE-A4 (230–239) HLA-A*02:01 GVYDGREHTV MAGE-A4 (230–239) HLA-A*02:01 GVYDGREHTV gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen... | 80,63 | ||
P3052.9505 | MUC-1 (12-20) HLA-A*02:01 LLLLTVLTV MUC-1 (12-20) HLA-A*02:01 LLLLTVLTV gehört zu den T-Zell-Epitop-Peptiden. Mit MUC-1 Peptiden können spezifische zytotoxische T-Lymphozytenreaktionen bei... | 93,43 | ||
P3053.9505 | MUC-1 (13-21) HLA-A*02:01 LLLTVLTVV MUC-1 (13-21) HLA-A*02:01 LLLTVLTVV gehört zu den T-Zell-Epitop-Peptiden. Mit MUC-1 Peptiden können spezifische zytotoxische T-Lymphozytenreaktionen bei... | 93,43 | ||
P2955.9505 | humanes LL-37 - scrambled - GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is... | 241,40 | ||
P3093.9505 | p53 (187-197) HLA-A*02:01 GLAPPQHLIRV | 108,75 | ||
P2965.70PP | MAGE-A3 Peptid-Pool - human MAGE A3 Control Pool bestehend aus 76 Peptiden basierend auf einem Peptid-Scan (15-mere mit 11 AA Überlappung) des Melanoma-associated Antigen 3 (MAGE A3)... | 225,00 | ||
P2770.9505 | HBV envelope (348-357) (HLA-A*02:01) - GLSPTVWLSV Das HBV envelope 348-357 (HLA-A*02:01)Peptid mit der Sequenz: GLSPTVWLSV für die Stimulierung antigenspezifischer T-Zellen in T-Zell-Assays wie ELISPOT-,... | 72,00 | ||
P2771.9505 | HBV HBsAg (371-378) (H2-Kb) - IVSPFIPL Das HBV HBsAg (371-378) (H2-Kb) Peptid mit der Sequenz: IVSPFIPL ist ein Peptidepitop (Epitop ID29454), das als Teil des Large-Envelope-Proteins des... | 72,00 | ||
P2772.9505 | HBV HBsAg (190-197) (H-2 Kb) - VWLSVIWM Das HBV HBsAg (190-197) (H-2 Kb Peptid mit der Sequenz: VWLSVIWM ist ein Peptidepitop (Epitop ID71948), das als Teil des Large-Envelope-Proteins des... | 72,00 | ||
P2429.9505 | [beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS The KLVFF peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived... | 103,27 | ||
P2432.9505 | [beta]-Bag Cell Peptide - RLRFH Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia (1). They trigger a series of... | 85,50 | ||
M3104.0050 | Rinderalbumin (BSA), sehr niedriges Endotoxin Hitzebehandeltes Albumin (entsprechend 10 Stunden bei 60°C). IgG nicht nachweisbar. Frei von Mycoplasma und Rinderviren. Frei von Caprylsäure und von anderen... | 86,05 | ||
P2599.9505 | ACTH (1-16). human SYSMEHFRWGKPVGKK ACTH (1-16), human SYSMEHFRWGKPVGKK ist ein synthetisches Peptid entsprechend den ersten 16 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der Name... | 238,00 | ||
P2589.9505 | Ac-ACTH (1-17). human Ac-SYSMEHFRWGKPVGKKR Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR ist ein synthetisches Peptid entsprechend den ersten 17 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der... | 238,00 | ||
P2493.9505 | [Glu10]-ACTH (1-17). human SYSMEHFRWEKPVGKKR [Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR ist ein synthetisches Peptid entsprechend den ersten 17 Aminosäuren des humanen ACTH/Adrenocorticotropin, wobei... | 238,00 | ||
C4306.0001 | Heparin Natriumsalz aus Schweinedarm Heparin ist hauptsächlich für eine verzögerte Blutgerinnung verantwortlich. Es verstärkt die Antithrombin-vermittelte Inaktivierung von Proteasen im... | 129,07 | ||
C6468.0500 | humanes FSH - Follikel stimulierendes Hormon Sowohl bei Männern als auch bei Frauen stimuliert FSH die Reifung von Keimzellen. Bei Frauen initiiert FSH das Follikelwachstum, das speziell Granulosazellen... | 153,83 | ||
P2720.9505 | EBV LMP-2 (419-427) HLA-A*24:02 TYGPVFMCL EBV LMP-2 (419-427) HLA-A*24:02 TYGPVFMCL | 76,00 | ||
S5340.0100 | SARS-CoV-2 Spike S1 Protein (RBD) mit His-Tag SARS-CoV-2 Spike Protein RBD Recombinant mit C-terminalem His-Tag ist ein rekombinantes Protein, das in flüssiger Form, gepuffert in PBS, vorliegt. Dieses... | Peptides and Proteins | 384,31 | |
S5237.0005 | Lysozym aus Hühnereiweiß, min. 20.000 U/mg Das Enzym Lysozym (N-Acetylmuramide glycanhydrolase) greift die Zellwände von Bakterien an. In der Molekularbiologie wird es aus Hühnereiweiß zur Lyse von E.... | 76,31 | ||
C6003.0050 | Coronavirus 2019 Nucleocapsid Mosaic Protein The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused... | Peptides and Proteins | 250,64 | |
S5341.0050 | SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag... | Peptides and Proteins | 1108,38 | |
S5342.0050 | SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc... | Peptides and Proteins | 1108,38 | |
S5343.0050 | SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic - with His-Tag SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and... | Peptides and Proteins | 250,64 | |
S5346.0050 | SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (800-1000 a.a.)... | Peptides and Proteins | 250,64 | |
S5347.0050 | SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.)... | Peptides and Proteins | 250,64 | |
P4000.9501 | SARS-CoV SSp-1 A2 (HLA-A*02:01) - RLNEVAKNL SARS-CoV SSp-1 A2 (HLA-A*02:01) - RLNEVAKNL | 106,25 | ||
P4001.9501 | SARS-CoV-2 Nucleocapsid A2 (138-146) ALNTPKDHI SARS-CoV-2 Nucleocapsid A2 peptide with amino acids 138-146 (ALNTPKDHI) | 106,25 | ||
P4002.9501 | SARS-CoV-2 Nucleocapsid A2 (316-324) GMSRIGMEV SARS-CoV-2 Nucleocapsid A2 peptide GMSRIGMEV with amino acids 316-324 is an antigen-specific SARS-CoV-2 peptide. | 106,25 | ||
P4003.9501 | SARS-CoV-2 Nucleocapsid A2 (219-227) - LQLPQGTTL SARS-CoV-2 Nucleocapsid A2 peptide LQLPQGTTL with amino acids 219-227 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. | 106,25 | ||
P4004.9501 | SARS-CoV-2 Nucleocapsid A2 (226-234) LALLLLDRL SARS-CoV-2 Nucleocapsid A2 peptide with amino acids 226-234 (LALLLLDRL) | 106,25 | ||
P4005.9501 | SARS-CoV-2 Membrane GP A2 (61-70) TLACFVLAAV SARS-CoV-2 Membrane GP A2 TLACFVLAAV with amino acids 61-70 of the Membrane GP A2 protein is an antigen-specific SARS-CoV-2 peptide. | 106,25 | ||
P4006.9501 | SARS-CoV-2 Nucleocapsid A2 (N223-231) LLLDRLNQL SARS-CoV-2 Nucleocapsid A2 peptide with amino acids N223-231 (LLLDRLNQL) | 106,25 | ||
P4007.9501 | SARS-CoV-2 Nucleocapsid _1 B7 FPRGQGVPI SARS-CoV-2 Nucleocapsid _1 B7 FPRGQGVPI is an antigen-specific SARS-CoV-2 peptide. | 106,25 | ||
P4008.9501 | SARS-CoV-2 Nucleocapsid _2 B7 SPRWYFYYL SARS-CoV-2 Nucleocapsid _1 B7 FPRGQGVPI is an antigen-specific SARS-CoV-2 peptide. | 106,25 | ||
P4009.9501 | SARS-CoV-2 Nucleocapsid _3 B7 KPRQKRTAT SARS-CoV-2 Nucleocapsid _3 B7 KPRQKRTAT is an antigen-specific SARS-CoV-2 peptide. | 106,25 | ||
P2293.9501 | FLAG-Peptid - DYKDDDDK Das DYKDDDDK-Peptid (Peptidsequenz: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, inklusive einer Enterokinase-Schnittstelle) wurde speziell für die... | 140,00 | ||
P2757.9501 | gp100 (280-288) HLA-A*02:01 YLEPGPVTA gp100 (280-288) HLA-A*02:01 YLEPGPVTA is a linear peptidic epitope studied as part of Melanocyte protein PMEL from Homo sapiens (human). gp100 peptide... | 78,00 | ||
P2300.9501 | 3x FLAG Peptid - DYKDDDDK-DYKDDDDK-DYKDDDDK Das DYKDDDDK-Peptid wurde speziell für die Immunaffinitätschromatographie entwickelt. Das Peptid erlaubt die kompetitive Elution von Proteinen... | 246,13 | ||
P2286.9501 | Nona-Arginin - Arg9 (R9) Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie... | 116,00 | ||
P2265.9501 | MOG (35-55) Ratte/Maus MEVGWYRSPFSRVVHLYRNGK Das MOG Peptidfragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment) induziert eine autoimmune Encephalomyelitis bei Nagetieren ähnlich MS. | 168,00 | ||
P2275.9501 | Ova (257-264) SIINFEKL Ovalbumin (257-264) chicken has been used to trigger T cell activation in immunology studies. Ova (257-264) - SIINFEKL gehört zu den T-Zell-Epitop-Peptiden.... | 116,00 | ||
P2299.9501 | humanes LL-37 [LL-37, 37 aa] LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is... | Peptides and Proteins | 252,49 | |
P2669.9501 | CMV IE-1 (199-207) - ELRRKMMYM CMV IE-1 ELRRKMMYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human... | 72,00 | ||
P2678.9501 | CMV pp65 (417-426) HLA-B*07:02 TPRVTGGGAM CMV pp65 (417 – 426) HLA-B*07:02 TPRVTGGGAM zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von MHC-Klasse-I-Molekülen präsentiert... | 108,75 | ||
P2678.0138 | HCMVA (pp65) Peptid-Pool CMV pp65 Control Pool bestehend aus 138 Peptiden basierend auf einem Peptid-Scan (15-mere mit 11 AA Überlappung) des 65 kDa Phosphoproteins (pp65) (UniProtKB... | 265,00 | ||
P3282.9501 | CMV pp65 (417-426), amid TPRVTGGGAM-NH2 CMV pp65 (417-426) HLA-B*07:02 TPRVTGGGAM zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von MHC-Klasse-I-Molekülen präsentiert... | 140,25 | ||
P2676.9501 | CMV pp65 (16-24) HLA-A*11:01 - GPISGHVLK CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von MHC-Klasse-I-Molekülen präsentiert wird.... | 72,00 | ||
P2296.9501 | CMV pp65 (495-503) HLA-A*02:01 NLVPMVATV Peptidfragment (NLVPMVATV) zur Stimulation von humanen CMV spezifischen CD8+ T-Zellen. Die Peptidsequenz entspricht der vom MHC class I HLA-A*0201 Allel... | 116,00 | ||
P2281.9501 | Melan-A / MART-1 (26-35) - EAAGIGILTV - A*02:01 Melan-A / MART-1 (26-35) - EAAGIGILTV gehört zur Gruppe der T-Zell-Epitop-Peptide. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden... | 116,00 | ||
P2974.9505 | Melan-A / MART-1 (26-35) - EAAGIGILTY - B*35:01 Melan-A / MART-1 (26-35) - EAAGIGILTY HLA B*35:01 gehört zur Gruppe der T-Zell-Epitop-Peptide. T-Zell-Epitope werden auf der Oberfläche von... | 80,00 | ||
P2508.9501 | [Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV [Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV ist ein Melan-A analoges Peptid bei dem Ala in Position 27 durch Leu ersetzt wurde. Dadurch zeigt das Peptid... | 74,16 | ||
P2816.9501 | HER-2/neu (63-71) HLA-A*24:02 TYLPTNASL HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL. HER2 ist die Abkürzung für die englische Bezeichnung „human epidermal growth factor receptor 2“. HER2 wird... | 72,00 | ||
P2277.9501 | Influenza A MP (58-66) HLA-A*02:01 GILGFVFTL Influenza A matrix protein (58-66) - GILGFVFTL. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert.... | 116,00 | ||
P2278.9501 | HIV-1 p17 Gag (77-85) HLA-A*02:01 SLYNTVATL HIV-1 p17 Gag (77-85) - SLYNTVATL gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch... | 116,00 | ||
P4010.9501 | SARS-CoV-2 Surface GP A2 (1000-1008) - YLQPRTFLL SARS-CoV-2 Surface GP A2 peptide with amino acids YLQPRTFLL | 131,25 | ||
P4011.9501 | SARS-CoV-2 Nucleocapsid A1 (865-873) - LTDEMIAQY SARS-CoV-2 Nucleocapsid A1 peptide with amino acids LTDEMIAQY | 106,25 | ||
P4012.9501 | SARS-CoV-2 Nucleocapsid A3 (378-386) - KCYGVSPTK SARS-CoV-2 Nucleocapsid A3 peptide with amino acids KCYGVSPTK | 285,00 | ||
P2763.9501 | HBV core (117-125) (HLA-A*24:02) - EYLVSFGVW Das HBV core (117-125) (HLA-A*24:02) Peptid mit der Sequenz EYLVSFGVW ist ein lineares peptidisches Epitop (Epitop ID15061), das als Teil des Capsid-Proteins... | 109,13 | ||
P2764.9501 | HBV core (18-27) (HLA-A*02:01) - FLPSDFFPSV Das HBV core (18-27) (HLA-A*02:01) Peptid mit der Sequenz FLPSDFFPSV stell ein lineares Peptid-Epitop dar, das als Teil des Capsid-Proteins des Hepatitis... | 109,13 | ||
S5348.0100 | SARS-CoV-2 (COVID-19) Nucleocapsidprotein - (1-419), His-Tag Das neue Coronavirus SARS-CoV-2 besteht unter seiner Hüllmembran aus einem ikosaedrischen Nukleokapsid, das seine genetische Information in Form von... | Peptides and Proteins | 513,71 | |
S5334.0100 | SARS-CoV-2 Spike S1 Protein (RBD) - ohne Tag SARS-CoV-2 Spike Protein RBD Recombinant ohne His-Tag ist ein rekombinantes Protein, das in flüssiger Form, gepuffert in PBS, vorliegt. Dieses Protein wurde... | Peptides and Proteins | 304,62 | |
S5333.0100 | SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilisiertes Trimer Das SARS-CoV Spike (S) Glykoprotein ist für die Bindung des Virus an die Wirtszelle und die Membranfusion zu Beginn des Infektionsprozesses essentiell und... | Peptides and Proteins | 588,16 | |
P4013.0027 | Variant B.1.617.2 (Delta) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) The Variant B.1.617.2 (Delta) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) with 27 peptides covers all mutations in the Spike Glycoprotein derived from the... | 262,65 | ||
P4014.0316 | SARS-CoV-2 (Spike Glycoprotein) Peptide Pool - 316 peptides SARS-CoV-2 (Spike Glycoprotein) Peptide Pool of 316 overlapping peptides (delivered in two subpools of 158 & 158 peptides) derived from a peptide scan... | 592,25 | ||
S5344.0100 | rekombinantes humanes ACE2 Protein (ECD), Avi/His-Tag, nicht biotinyliert Rekombinantes humanes ACE2-Protein (ECD. prozessiert) enthält einen Avi/His-Tag und ist bereit für die In-vitro-Biotinylierung, Wir bieten hohe Reinheit. und... | Peptides and Proteins | 722,95 | |
S5349.0100 | hACE2 Protein (ECD, processed), Tag-free, liquid formulation Rekombinantes humanes ACE2-Protein (ECD. prozessiert), Wir bieten hohe Reinheit. und Qualität in HEK293 exprimiertes rekombinantes Protein für F&E made in... | Peptides and Proteins | 722,95 | |
S5361.0100 | human ACE2 Protein (ECD), Avi/His-Tag, biotinylated Rekombinantes humanes ACE2-Protein (ECD. prozessiert) enthält einen Avi/His-Tag und ist biotyniliert, Wir bieten hohe Reinheit. und Qualität in HEK293... | Peptides and Proteins | 1090,55 | |
P2288.9501 | HIV-1 TAT (47-57) YGRKKRRQRRR-NH2 (Amid) Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie... | 295,00 | ||
P2276.9501 | Influenza A NP (366-374) H-2 Db ASNENMETM Influenza A NP (366-374) - ASNENMETM. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese... | 116,00 | ||
P2279.9501 | HCV NS5B (2594-2602) HLA-A*02:01 ALYDVVTKL We identified a relatively high degree of amino acid sequence similarity between HLA-A2-restricted epitopes HIV (HXB2) gag: 77-85 (SLYNTVATL: SL9) and HCV... | 123,06 | ||
P2270.9501 | MOG (183-191) - FVIVPVLGP MOG (183-191) FVIVPVLGP repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind offensichtlich Ziele... | 116,00 | ||
P2867.9501 | HIV-1 RT (476-484) HLA-A*02:01 ILKEPVHGV Die Sequenz ILKEPVHGV ist Teil des Gag-Pol-Polyproteins aus dem Humanen Immunschwächevirus 1. Das Peptid wurde für Studien zu HIV-1 und zur Stimulation... | 108,75 | ||
P2846.9501 | HIV Pol HLA-A*02:01 VIYHYVDDL | 108,75 | ||
P2290.9501 | HIV TAT (48-60) GRKKRRQRRRPPQ-NH2 (Amid) Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie... | 132,00 | ||
P2814.9501 | HER-2/neu (369-377) HLA-A*02:01 KIFGSLAFL HER-2/neu (369-377) HLA-A*02:01 KIFGSLAFL. HER2 ist die Abkürzung für die englische Bezeichnung „human epidermal growth factor receptor 2“. HER2 wird... | 72,00 | ||
P2881.9501 | HPV 16 E7 (49-57) H-2 Db RAHYNIVTF RAHYNIVTF entspricht dem linearen Epitop, das als Teil von Protein E7 (Alphapapillomavirus 9) und anderen Human-Papillomavirus-Proteinen untersucht wurde.... | 108,75 | ||
P2295.9501 | EBV BMLF-1 280-288 (HLA-A*02:01) GLCTLVAML Peptidfragment GLCTLVAML zur Stimulation von T-cells, speziell humanen EBV BMLF-1(280-288) CD8+ T-Zellen. Die Peptidsequenz entspricht der vom MHC class I... | 116,00 | ||
P2280.9501 | LCMV GP (33-41) KAVYNFATM LCMV GP (33-41) mit der Peptidsequenz KAVYNFATM stellt ein T-Zell-Epitop dar, das auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle... | 116,00 | ||
P4016.0025 | Variant B.1.617.1 (Kappa ) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) This peptide pool with 25 peptides covers all mutations in the Spike Glycoprotein derived from the kappa variant B.1.617.1 of SARS-CoV-2 which emerged in... | 262,65 | ||
P3288.9501 | Ova (323-339) Homolog - ISQAVHAARAEINEAGR-NH2 (Amid) Ova (323-339) - T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind in der... | 116,70 | ||
P2775.9501 | CMV IE-1 (316-324) HLA-A*0201 VLEETSVML CMV IE-1 (316-324) HLA-A*0201 VLEETSVML zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von MHC-Klasse-I-Molekülen präsentiert wird.... | 116,00 | ||
P2780.0315 | Variante Omicron B.1.1.529 Peptid Pool SARS-CoV-2 full length (Spike Glycoprotein) Peptidpool der neuen Omicron-Variante von SARS-CoV-2 (315 Peptide, aufgeteilt in zwei Subpools von 158 und 157 Peptiden) umfasst das gesamte... | 836,58 | ||
P2781.0080 | Variante Omicron B.1.1.529 Peptid Pool SARS-CoV-2 (Spike Glycoprotein) Dieser Pool besteht aus 80 Peptiden des Spike-Proteins und deckt nur die Mutationen der neuen Omicron-Variante von SARS-CoV-2 (B.1.1.529). | 283,25 | ||
P2783.0031 | Eta Variante (B.1.525) Peptid Pool SARS-CoV-2 (Spike Glycoprotein) Dieser Peptidpool mit 31 Peptiden deckt alle Mutationen im Spike-Glykoprotein ab, die von der Eta-Variante B.1.525 von SARS-CoV-2 stammen. | 262,65 | ||
P2782.0014 | Epsilon Variante (B.1.427/B.1.429) Peptid Pool SARS-CoV-2 (Spike Glycoprotein) Peptid pool epsilon Variante B.1.427/B.1.429 (SARS-CoV-2), umfasst 14 Peptide, die alle Mutationen dieser Variante im Spike-Glykoprotein abdecken. Mögliche... | 262,65 | ||
P2282.9501 | MAGE-A3 (271-279) HLA-A*02:01 FLWGPRALV MAGE-A3 (271-279) FLWGPRALV Antigen gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch... | 116,00 | ||
P4015.0102 | SARS-CoV-2 (N-Protein) - Peptid-Pool The peptide pools is derived from a peptide scan (15mers with 11 aa overlap - UniProt: P0DTC9) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related... | 262,65 | ||
P2284.9501 | PADRE - AKFVAAWTLKAAA pan-HLA-DR-bindendes Epitop (PADRE) wurde als ein einfaches Epitoppeptid vorgeschlagen. Dieser Mechanismus stellt sicher, dass die Zellen, die durch Viren... | 148,53 | ||
P2271.9501 | MBP (1-11) Human - Ac-ASQKRPSQRHG MBP (1-11) Human - Ac-ASQKRPSQRHG repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind... | 116,00 | ||
P2272.9501 | MBP (54-72) Human - SHHAARTTHYGSLPQKSQR Multiple Sklerose (MS) ist eine Autoimmunerkrankung des zentralen Nervensystems (ZNS) die durch primäre Demyelinisierung charakterisiert ist. Es wird... | 232,00 | ||
P2264.9501 | MOG (91-108) rat SDEGGYTCFFRDHSYQEE MOG (91-108) SDEGGYTCFFRDHSYQEE repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind... | 232,00 | ||
P2301.9501 | EBNA-1 Protein (562-570) FMVFLQTHI The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo... | Peptides and Proteins | 116,00 | |
P2351.9501 | [Ala13] Apelin QRPRLSHKGPMPA Apelin (auch als APLN bekannt) ist ein Peptid, das beim Menschen vom APLN-Gen kodiert wird. Es ist in verschiedenen Organen wie Herz, Lunge, Niere, Leber,... | 140,00 | ||
P2358.9501 | [Ala9] Autocamtide 2 - KKALRRQEAVDAL | 146,25 | ||
P2359.9501 | [alpha]-Bag Cell Peptide (1 - 7) - APRLRFY Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia (1). They trigger a series of... | 100,00 | ||
P2361.9501 | [alpha]-Bag Cell Peptide (1 - 9) - APRLRFYSL Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia (1). They trigger a series of... | 100,00 | ||
P2767.9501 | HBV core antigen (88-96) (HLA-A*11:01) - YVNVNMGLK Das HBV core antigen (88-96) (HLA-A*11:01) Peptid mit der Sequenz YVNVNMGLK ist ein lineares peptidisches Epitop (Epitop ID76370), das als Teil des... | 109,13 | ||
P2766.9501 | HBV core (19-27) (HLA-B*35:01) (HLA-B*51:01) - LPSDFFPSV Das HBV core (19-27) (HLA-B*35:01) (HLA-B*51:01) Peptid mit der Sequenz LPSDFFPSV ist ein lineares peptidisches Epitop (Epitop ID38701), das als Teil des... | 109,13 | ||
P2765.9501 | HBV core (18-27) (subtype ADR4) (HLA-A*02:01) - FLPSDFFPSI Das HBV core (18-27) (subtype ADR4) (HLA-A*02:01) Peptid mit der Sequenz FLPSDFFPSI ist ein lineares Peptid-Epitop (Epitop ID16832), das als Teil des... | 109,13 | ||
P2768.9501 | HBV envelope (183-191) (HLA-A*02:01) - FLLTRILTI The HBV envelope (183-191) (HLA-A*02:01) Peptid mit der Sequenz: FLLTRILTI stellt ein Peptidepitop dar (Epitop ID16755) das als Teil des großen... | 109,13 | ||
C6380.0001 | rek. humanes Serumalbumin (rHSA) Synonyme: Serum albumin, ALB, PRO0883, PRO0903, PRO1341, DKFZp779N1935, GIG20, GIG42, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696, SA, HSA. | 583,50 | ||
M6380.0001 | rek. humanes Serumalbumin (rHSA) - aus Pflanzen Synonyme: Serum albumin, ALB, PRO0883, PRO0903, PRO1341, DKFZp779N1935, GIG20, GIG42, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696, SA, HSA. | 382,13 | ||
C6467.0800 | LH - Luteinisierendes Hormon aus Schwein LH (Luteinisierendes Hormon) aus Schwein ist ein Hormon das die Follikelreifung stimuliert, den Eisprung induziert, sowie die Bildung von Corpus luteum und... | 122,00 | ||
P2784.0315 | Variante Omicron B.1.1.529 BA.5 Peptid Pool SARS-CoV-2 full length (Spike Glycoprotein) Peptidpool der Omicron-Variante B.1.1.529 BA.5 von SARS-CoV-2 (315 Peptide, aufgeteilt in zwei Subpools von 158 und 157 Peptiden) umfasst das gesamte... | 836,58 | ||
S5553.0100 | rHu Vitronectin Rekombinantes humanes Vitronectin (rhnVN) von Genaxxon ist ein rekombinantes humanes Protein, das eine definierte Oberfläche für die feederfreie Kultur aller... | 246,49 | ||
P2762.9501 | HBV Polymerase (455-463) (HLA-A*02:01) - GLSRYVARL Das HBV Pol (455-463) (HLA-A*02:01) Peptid mit der Sequenz: GLSRYVARL stellt ein Peptidepitop dar (Epitop ID21145), das als Teil der Hepatitis B Virus... | 109,13 |
1
MBP 54-72 Human gp100 280-288 Ova 257-264 Ova 257-264 hGHRP-2 Human Trypsin aus rek. humanes FSH - HIV-1 TAT 47-57 Leu27 - Melan-A Collagenase Typ PRAME 301-309 p53 187-197 p53 264-272 Tyrosinase GHRP-6 Collagenase Typ EBV LMP-2 Collagenase Typ humanes LL-37 - MBP 1-11 Human HIV TAT 48-60 Rinderalbumin Ova 323-339 Melan-A MART-1 HCMVA pp65 HBV Polymerase human ACE2 HER-2 neu humanes LL-37