Order number: P2259.7005

Shipping: shipped at RT, store at -20°C

Ready to ship today,
Delivery time 1-3 workdays

€211.69 *


Please select the favoured pack size.


Please select the favoured purity.

Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ. Several inhibitors of amyloid-beta aggregation have... more
Product information "Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ"

Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ. Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about peptides that target amyloid-beta is described by Stains et al. (2007) ChemMedChem 2, 1674-1692.

Related products:
P2255 - Amyloid-beta (16-20) - KLVFF >
P2304 - Amyloid-beta (10-20) - YEVHHQKLVFF >
P2250 - Amyloid-beta (1-40) human - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >
P2248 - Amyloid-beta (1-40) rat - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >

More products around "Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ"
Specifications: Sequence: PGRSPFTGKKLFNQEFSQDQ Purity: >70% / >95% (HPLC) Appearance:... more

Technical Data:

Purity: >70% / >95% (HPLC)
Appearance: lyophilized, white powder



Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads more

Dokumente - Protokolle - Downloads

Here you will find information and further literature on Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: or phone: +49 731 3608 123.