ACTH (4-10), human MEHFRWG

ACTH (4-10), human MEHFRWG


Order number: P2607.9505

Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.

Quantity Unit price
To 2 €90.00 *
From 3 €85.50 *

Weight:

Please select the favoured pack size.

Purity:

Please select the favoured purity.

ACTH (4-10), human MEHFRWG is a synthetic peptide according to the amino acids 4 to 10 of... more
Product information "ACTH (4-10), human MEHFRWG"

ACTH (4-10), human MEHFRWG is a synthetic peptide according to the amino acids 4 to 10 of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates secretion of glucocorticoids such as cortisol, and has little control over secretion of aldosterone, the other major steroid hormone from the adrenal cortex. Stimulates secretion of adrenal corticosteroids and induces growth of adrenal cortex. ACTH also called Tetracosactide directly activates G-proteins. It is also a stimulator of adenylate cyclase and cAMP formation.

More products around "ACTH (4-10), human MEHFRWG"
Specifications: Purity: >95% (HPLC, 214nm) Sequence: MEHFRWG Appearance: lyophilized white... more
 

Technical Data:

Specifications:
Purity: >95% (HPLC, 214nm)
Sequence: MEHFRWG
Appearance: lyophilized white powder

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads more

Dokumente - Protokolle - Downloads

Here you will find information and further literature on ACTH (4-10), human MEHFRWG. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.

 
 
 
Read, write and discuss reviews... more
Customer evaluation for "ACTH (4-10), human MEHFRWG"
Write an evaluation
Evaluations will be activated after verification.
Please enter these characters in the following text field.

The fields marked with * are required.

human growth hormon releasing factor 6 [D-Lys3]-GHRP-6
From €115.88 * €125.00 *
ACTH (1-10), human SYSMEHFRWG ACTH (1-10), human SYSMEHFRWG
From €85.50 * €90.00 *
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39), human...
From €441.75 * €465.00 *