No results were found for the filter!
Prod.Nr. | Description | Price € | ||
---|---|---|---|---|
P2351.9501 | [Ala13] Apelin QRPRLSHKGPMPA Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as the heart, lung,... | 140,00 | ||
P2358.9501 | [Ala9] Autocamtide 2 - KKALRRQEAVDAL | 146,25 | ||
P2359.9501 | [alpha]-Bag Cell Peptide (1 - 7) - APRLRFY Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia (1). They trigger a series of... | 100,00 | ||
P2361.9501 | [alpha]-Bag Cell Peptide (1 - 9) - APRLRFYSL Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia (1). They trigger a series of... | 100,00 | ||
P2304.9505 | [beta]-Amyloid (10-20) - YEVHHQKLVFF [beta]-Amyloid (10-20) (peptide sequence: YEVHHQKLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-42 peptide.... | 249,31 | ||
P2429.9505 | [beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS Amino acid sequence RERMS represents the active domain of amyloid beta/A4 protein precursor that promotes fibroblast growth; H. Ninomiya, et al.; J. Cell.... | 103,27 | ||
P2432.9505 | [beta]-Bag Cell Peptide - RLRFH Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia (1). They trigger a series of... | 85,50 | ||
C6472.0005 | [D-Lys3]-GHRP-6 [D-Lys3]-GHRP6 (growth hormone releasing peptide 6) induces the secretion of growth hormone (GH). In the membrane of clonal GC somatotropes, this peptide... | 122,94 | ||
P2470.9505 | [Des-octanoyl]-Ghrelin, human GSSFLSPEHQRVQQRKESKKPPAKLQPR Ghrelin is a peptide hormone of 28 amino acids. The third amino acid serine of the natural ghrelin is modified with octanoic acid. This modification is... | 318,25 | ||
P2471.9505 | [Des-octanoyl]-Ghrelin, rat GSSFLSPEHQKAQQRKESKKPPAKLQPR Ghrelin is a peptide hormone of 28 amino acids. The third amino acid serine of the natural ghrelin is modified with octanoic acid. This modification is... | 318,25 | ||
P2493.9505 | [Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR [Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone ACTH/Adrenocorticotropic... | 238,00 | ||
P2508.9501 | [Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV [Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV - (HLA-A*02:01) an analog of Melan-A, with Leu substituted for Ala at position 27, shows better HLA-A*0201... | 74,16 | ||
P2526.9505 | [Phe17] Apelin KFRRQRPRLSHKGPMPF Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as the heart, lung,... | 226,10 | ||
P2300.9501 | 3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK The DYKDDDDK peptide was developed specifically for immunoaffinity chromatography. The peptide allows the competitive elution of proteins (amino terminal,... | 246,13 | ||
P2589.9505 | Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone ACTH/Adrenocorticotropic... | 238,00 | ||
P2256.7005 | Ac-KLVFF-NH2 Ac-KLVFF-NH2 is the N-terminal and C-terminal modified form of the amyloid-beta (16-20) inhibitor peptid KLVFF. The modification leads to higher stability... | 163,46 | ||
P2598.9505 | ACTH (1-10), human SYSMEHFRWG ACTH (1-10), human SYSMEHFRWG is a synthetic peptide according to the first 10 amino acids of the human hormone ACTH/Adrenocorticotropic hormone.... | 72,00 | ||
P2599.9505 | ACTH (1-16), human SYSMEHFRWGKPVGKK ACTH (1-16), human SYSMEHFRWGKPVGKK is a synthetic peptide according to the first 16 amino acids of the human hormone ACTH/Adrenocorticotropic hormone.... | 238,00 | ||
P2612.9505 | ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the first 39 amino acids of the human hormone... | 441,75 | ||
P2603.9505 | ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the amino acids 18 to 39 of the human hormone ACTH/Adrenocorticotropic... | 261,25 | ||
P2607.9505 | ACTH (4-10), human MEHFRWG ACTH (4-10), human MEHFRWG is a synthetic peptide according to the amino acids 4 to 10 of the human hormone ACTH/Adrenocorticotropic hormone.... | 85,50 | ||
M3105.0005 | Albumin from hen egg white - Ovalbumin Albumin from chicken egg white (Ovalbumin). Min. 90% protein. | 226,29 | ||
S5228.0001 | alpha-Chymotrypsin (EC 3.4.21.1) α-Chymotrypsin is a serine peptidase that hydrolyzes peptide bonds with aromatic or large hydrophobic side chains (Tyr, Trp, Phe, Leu) on the carboxyl end of... | 71,15 | ||
P2424.9505 | Amyloid-beta (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA [beta]-Amyloid (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the... | 708,50 | ||
P2255.9505 | Amyloid-beta (16-20) KLVFF inhibitor peptide of Amyloid-beta The KLVFF peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived... | 103,27 | ||
P2259.7005 | Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ. Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified... | 224,58 | ||
P2291.9505 | Antennapedia (43-58) penetratin Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie... | 206,00 | ||
C6453.0005 | Antide Acetate Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s body to represses FSH and LH releases that stem from the... | 192,33 | ||
M3100.0005 | Bovine albumin crystallized, free of fatty acid, free of globulin Crystallised Albumin is the purest form of the GENAXXON bovine albumins. It contains no crystallisation agents or other contaminants. | 112,88 | ||
M3101.0050 | Bovine albumin for EIA and RIA Compatible with many diagnostic enzymes and components. Primarily monomeric albumin. IgG not detectable | 61,54 | ||
M3103.0025 | Bovine albumin Fraction V (pH 7.0) Lyphilisiertes Albumin (Standardreinheit). Serumalbumin vom Rind (BSA) wird häufig zur Stabilisierung von Proteinen den entsprechenden Puffern zugesetzt. Die... | 73,13 | ||
M3104.0050 | Bovine Serum Albumin, very low endotoxin, no IgG Heat treated (equivalent to 10 hours at 60°C). IgG not detectable. Free of mycoplasma and bovine viruses. Free from capryllic acid or other stabilisers that... | 86,05 | ||
P2655.9505 | CD20 188-196 (HLA-A*02:01) HLA-A*02:01 SLFLGILSV | 85,50 | ||
P2659.9505 | CD22-4 (371-379) HLA-A*02:01 RLLGKESQL | 85,50 | ||
S5230.0005 | Chymotrypsinogen A - Chymotrypsin precursor Chymotrypsinogen is the practically inactive "precursor" (proenzyme, or zymogen) of chymotrypsin. In order to be activated, chymotrypsinogen has to be... | 407,31 | ||
P2669.9501 | CMV IE-1 (199-207) - ELRRKMMYM CMV IE-1 ELRRKMMYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human... | 72,00 | ||
P2909.9505 | CMV IE-1 (316-324) (I1) HLA-A*02:01 ILEETSVML Antigen peptide IE (316-324) (I1) HLA-A*02:01 (ILEETSVML) for stimulation of antigen-specific T cells in T cell assay such as ELISPOT, ICS, cytotoxicity or... | 76,00 | ||
P2775.9501 | CMV IE-1 (316-324) HLA-A*0201 VLEETSVML CMV IE-1 (316-324) HLA-A * 0201 VLEETSVML for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. IE-1 stands for... | 116,00 | ||
P2910.9505 | CMV IE-1 (99-107) RIKEHMLKK IE-1 stands for immediate-early protein 1. CMV stands for human cytomgealovirus, HCMV for human cytomegalovirus or HPV human herpesvirus. | 76,00 | ||
P2674.9505 | CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von MHC-Klasse-I-Molekülen präsentiert wird.... | 85,50 | ||
P2676.9501 | CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for human... | 72,00 | ||
P2678.9501 | CMV pp65 (417-426) HLA-B*07:02 TPRVTGGGAM CMV pp65 (417-426) HLA-B * 07: 02 TPRVTGGGAM for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for... | 108,75 | ||
P3282.9501 | CMV pp65 (417-426), amid HLA-B*07:02 TPRVTGGGAM-NH2 CMV pp65 (417-426) HLA-B * 07: 02 TPRVTGGGAM for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for... | 140,25 | ||
P2296.9501 | CMV pp65 (495-503) HLA-A*02:01 NLVPMVATV Single peptide (NLVPMVATV) for stimulation of human CMV specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201... | 116,00 | ||
C4255.0100 | Collagenase Type I (EC 3.4.24.3) >100 units/mg Collagenase from Clostridium histolyticum lyophilised (>90 Mandl-Units / >90 CDU units/mg). Histolyticum clostridiopeptidase (EC 3.4.24.3). Natural balance... | 85,62 | ||
C4341.0100 | Collagenase Type II (EC 3.4.24.3) >180 units/mg Collagenase from Clostridium histolyticum lyophilised (>180 Mandl units / >180 CDU units). Histolyticum clostridiopeptidase (EC 3.4.24.3). Genaxxon... | 86,32 | ||
C4346.2000 | Collagenase Type III (EC 3.4.24.3) Collagenase from Clostridium histolyticum lyophilised (125 to 250 Mandl-Units). Histolyticum clostridiopeptidase (EC 3.4.24.3). Genaxxon Collagenase Typ III... | 1405,69 | ||
C4310.0100 | Collagenase Type IV (EC 3.4.24.3) >900 units/mg Collagenase from Clostridium histolyticum lyophilised (>900 Mandl units / >900 CDU units). Histolyticum clostridiopeptidase (EC 3.4.24.3). Enzyme mixture of... | 108,47 | ||
P2252.0001 | Control peptide Amyloid-beta (40-1) human Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42... | 260,71 | ||
P2251.0001 | Control peptide Amyloid-beta (40-1) rat Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42... | 260,71 | ||
C6003.0050 | Coronavirus 2019 Nucleocapsid Mosaic Protein The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused... | Peptides and Proteins | 250,64 | |
P2292.9501 | CyLoP-1 peptide (CRWRWKCCKK) CPPs, such as CyloP-1, are generally taken up by endocytic pathways, with vesicular encapsulation being a limiting factor in intracellular targeting. CyLoP-1... | 144,00 | ||
P2287.9501 | D-Arg9 (r9) - Nona-D-Arginine CPPs are usually short peptides with less than 30 amino acids. They are mostly amphipathic and highly cationic and usually rich of the amino acids arginine... | 311,25 | ||
P2302.7005 | D-Arg9 (r9) - Nona-D-Arginine amidated C-terminus Nona-D-Arginine (r9, respective sequence: rrrrrrrrr-NH2) belongs to the group of cell penetrating peptide (CPPs) which are characterised by their ability to... | 287,79 | ||
P2308.7005 | D-Arg9 (r9) - Nona-D-Arginine modified termini CPPs are usually short peptides with less than 30 amino acids. They are mostly amphipathic and highly cationic and usually rich of the amino acids arginine... | 287,79 | ||
P2289.9501 | D-TAT (47-57) ygrkkrrqrrr-NH2 Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie... | 296,13 | ||
P2258.7005 | DWGKGGRWRLWPGASGKTEA - Inhibitor Peptide of amyloid-ß DWGKGGRWRLWPGASGKTEA peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified... | 224,54 | ||
P2301.9501 | EBNA-1 Protein (562-570) FMVFLQTHI The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo... | Peptides and Proteins | 116,00 | |
P2295.9501 | EBV BMLF-1 280-288 (HLA-A*02:01) GLCTLVAML Single peptide (GLCTLVAML) for stimulation of humanEBV BMLF-1(280-288) CD8+ specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC... | 116,00 | ||
P2695.9505 | EBV BMRF1 (208-216) HLA-A*02:01 TLDYKPLSV The Epstein–Barr virus (EBV), formally called Human gammaherpesvirus 4, is one of eight known human herpesvirus types in the herpes family, and is one of the... | 72,00 | ||
P2706.9505 | EBV EBNA-1 (407-417) HLA-B*35:01 HPVGEADYFEY | 76,00 | ||
P2709.9505 | EBV EBNA-3A (325-333) HLA-B*08:01 FLRGRAYGL | 76,00 | ||
P2285.9501 | EBV EBNA-3A (379-387) HLA-B*07:02 RPPIFIRRL Single peptide (RPPIFIRRL) for stimulation of human EBV EBNA-3A (379-387) specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC... | 116,00 | ||
P2720.9505 | EBV LMP-2 (419-427) HLA-A*24:02 TYGPVFMCL EBV LMP-2 (419-427) HLA-A*24:02 TYGPVFMCL | 76,00 | ||
P2723.9505 | EBV LMP2 (131-139) HLA-A*24:02 PYLFWLAAI | 76,00 | ||
P2782.0014 | Epsilon Variant (B.1.427/B.1.429) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) Peptide pool with 14 peptides that covers all mutations in the Spike Glycoprotein derived from the epsilon variant B.1.427/B.1.429 of SARS-CoV-2. | 262,65 | ||
P2783.0031 | Eta Variant (B.1.525) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) This peptide pool with 31 peptides covers all mutations in the Spike Glycoprotein derived from the eta variant B.1.525 of SARS-CoV-2 which emerged in Angola... | 262,65 | ||
P2293.9501 | FLAG-Peptide - DYKDDDDK The DYKDDDDK peptide was specifically designed for immunoaffinity chromatography. It allows elution under mild and non-denaturing conditions. Several... | 140,00 | ||
P2261.7005 | FYLKVPSSLHHHHGRDKLVFFHHHH Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta... | 213,89 | ||
P2751.9505 | gp100 (154-162) HLA-A*02:01 KTWGQYWQV gp100 (154-162) HLA-A*02:01 KTWGQYWQV is a linear peptidic epitope (epitope ID 33915) studied as part of Melanocyte protein PMEL from Homo sapiens (human).... | 116,00 | ||
P2757.9501 | gp100 (280-288) HLA-A*02:01 YLEPGPVTA T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically... | 78,00 | ||
C6470.1000 | Growth-hormone-releasing hormone (GHRH) Human Growth Hormone Releasing Hormone (HuGHRH). The protein (1mg/mL) was lyophilized after extensive dialyses against 1.7mg sodium phosphate buffer (0.1mg... | 174,45 | ||
P2763.9501 | HBV core (117-125) (HLA-A*24:02) - EYLVSFGVW HBV core (117-125) (HLA-A*24:02) - EYLVSFGVW is a linear peptidic epitope (epitope ID15061) studied as part of Capsid protein from Hepatitis B virus and... | 109,13 | ||
P2764.9501 | HBV core (18-27) (HLA-A*02:01) - FLPSDFFPSV HBV core (18-27) (HLA-A*02:01) - FLPSDFFPSV is a linear peptidic epitope studied as part of Capsid protein from Hepatitis B virus and External core antigen... | 109,13 | ||
P2765.9501 | HBV core (18-27) (subtype ADR4) (HLA-A*02:01) - FLPSDFFPSI HBV core (18-27) (subtype ADR4) (HLA-A*02:01) - FLPSDFFPSI is a linear peptidic epitope (epitope ID16832) studied as part of External core antigen from... | 109,13 | ||
P2766.9501 | HBV core (19-27) (HLA-B*35:01) (HLA-B*51:01) - LPSDFFPSV HBV core (19-27) (HLA-B*35:01) (HLA-B*51:01) - LPSDFFPSV is a linear peptidic epitope (epitope ID38701) studied as part of Capsid protein from Hepatitis B... | 109,13 | ||
P2767.9501 | HBV core antigen (88-96) (HLA-A*11:01) - YVNVNMGLK HBV core antigen (88-96) (HLA-A*11:01) YVNVNMGLK is a linear peptidic epitope (epitope ID76370) studied as part of Capsid protein from Hepatitis B virus and... | 109,13 | ||
P2768.9501 | HBV envelope (183-191) (HLA-A*02:01) - FLLTRILTI HBV envelope (183-191) (HLA-A*02:01) - FLLTRILTI is a linear peptidic epitope (epitope ID16755) studied as part of Large envelope protein from Hepatitis B... | 109,13 | ||
P2770.9505 | HBV envelope (348-357) (HLA-A*02:01) - GLSPTVWLSV Antigen Peptide HBV envelope 348-357 (HLA-A*02:01) GLSPTVWLSV for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity... | 72,00 | ||
P2772.9505 | HBV HBsAg (190-197) (H-2 Kb) - VWLSVIWM HBV HBsAg (190-197) (H-2 Kb) - VWLSVIWM is a linear peptidic epitope (epitope ID71948) studied as part of Large envelope protein from Hepatitis B virus. This... | 72,00 | ||
P2771.9505 | HBV HBsAg (371-378) (H2-Kb) - IVSPFIPL HBV HBsAg (371-378) (H2-Kb) - IVSPFIPL is a linear peptidic epitope (epitope ID29454) studied as part of Large envelope protein from Hepatitis B virus. This... | 72,00 | ||
P2762.9501 | HBV Polymerase (455-463) (HLA-A*02:01) - GLSRYVARL HBV Polymerase (455-463) (HLA-A*02:01) - GLSRYVARL is a linear peptidic epitope (epitope ID21145) studied as part of the Hepatitis B virus polymerase. This... | 109,13 | ||
P2678.0138 | HCMVA (pp65) Peptide Pool Control Pool of 138 peptides derived from a peptide scan (15mers with 11 aa overlap) through 65 kDa phosphoprotein (pp65) (UniProtKB - P06725) of Human... | 265,00 | ||
P2799.9505 | HCV NS3 (1406-1415) (HLA-A*02:01) KLSGLGINAV | 108,75 | ||
P2279.9501 | HCV NS5B (2594-2602) HLA-A*02:01 ALYDVVTKL We identified a relatively high degree of amino acid sequence similarity between HLA-A2-restricted epitopes HIV (HXB2) gag: 77-85 (SLYNTVATL: SL9) and HCV... | 123,06 | ||
C4306.0001 | Heparin sodium salt from porcine intestinal mucosa Heparin is mainly responsible for delayed blood clotting. It enhances the antithrombin-mediated inactivation of proteases in the clotting pathway. Therefore,... | 129,07 | ||
P2814.9501 | HER-2/neu (369-377) HLA-A*02:01 KIFGSLAFL HER-2/neu (369-377) HLA-A*02:01 KIFGSLAFL. HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or... | 72,00 | ||
P2813.9505 | HER-2/neu (434-443) HLA-A*02:01 ILHDGAYSL HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL. HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or... | 108,75 | ||
P2815.9505 | HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL. HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or... | 72,00 | ||
P2816.9501 | HER-2/neu (63-71) HLA-A*24:02 TYLPTNASL HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL. HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or... | 72,00 | ||
C6471.0025 | hGHRP-2 / Human Growth Hormone Releasing Peptide-2 GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs to stimulate GH release. GHRP-2, an... | 140,69 | ||
P2306.9501 | Histatin 5: DSHAKRHHGYKRKFHEKHHSHRGY Histatin 5 (peptide sequence: DSHAKRHHGYKRKFHEKHHSHRGY) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a broad... | 225,00 | ||
P2837.9505 | HIV Gag (50-59) HLA-A*02:01 SLFNTVATLY HIV-1 p17 Gag (77-85) SLYNTVATL belongs to the T-Zell-Epitop-Peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC... | 72,00 | ||
P2846.9501 | HIV Pol HLA-A*02:01 VIYHYVDDL | 108,75 | ||
P2290.9501 | HIV TAT (48-60) GRKKRRQRRRPPQ-NH2 (amide) Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable... | 132,00 | ||
P2838.9505 | HIV-1 Gag (77-85) HLA-A*02:01 SLFNTVATL HIV-1 Gag (77-85) HLA-A*02:01 SLFNTVATL belongs to the T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by... | 72,00 | ||
P2278.9501 | HIV-1 p17 Gag (77-85) HLA-A*02:01 SLYNTVATL HIV-1 p17 Gag (77-85) SLYNTVATL belongs to the T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC... | 116,00 | ||
P2867.9501 | HIV-1 RT (476-484) HLA-A*02:01 ILKEPVHGV The sequence ILKEPVHGV is part of the Gag-Pol polyprotein from Human immunodeficiency virus 1. The peptide is used for studies on HIV-1 and stimulation of... | 108,75 | ||
P2288.9501 | HIV-1 TAT (47-57) YGRKKRRQRRR-NH2 Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable... | 295,00 | ||
P2881.9501 | HPV 16 E7 (49-57) H-2 Db RAHYNIVTF RAHYNIVTF represents the linear peptidic epitope studied as part of Protein E7 (Alphapapillomavirus 9) and other human papillomavirus protein. This epitope... | 108,75 | ||
S5361.0100 | human ACE2 Protein (ECD), Avi/His-Tag, biotinylated Recombinant human ACE2 protein (ECD. processed) contains an Avi/His tag and is biotinylated. We offer high purity. and quality in HEK293 expressed... | Peptides and Proteins | 1090,55 | |
S5349.0100 | Human ACE2 recombinant protein.(ECD, processed), Tag-free Recombinant human ACE2 protein (ECD. processed) Tag-free, liquid formulation. We offer high purity. and quality in HEK293 expressed recombinant protein for... | Peptides and Proteins | 722,95 | |
C6468.0500 | human FSH - Follicle stimulating Hormone In both males and females, FSH stimulates the maturation of germ cells. In females, FSH initiates follicular growth, specifically affecting granulosa cells.... | 153,83 | ||
P2955.9505 | human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR LL-37 human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating... | 241,40 | ||
P2299.9501 | human LL-37 [LL-37, 37 aa] LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating... | Peptides and Proteins | 252,49 | |
S5233.0001 | Hyaluronidase (EC 3.2.1.35) - min. 500 U/mg Hyaluronidase isolated from sheep testes. The mammalian glycolytic hyaluronidase (EC 3.2.1.35) catalyzes the hydrolysis of the 1-4 bond between... | 262,65 | ||
P2307.9501 | Indolicidin - ILPWKWPWWPWRR-NH2 Indolicidin (peptide sequence: ILPWKWPWWPWRR-NH2) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a broad spectrum... | 235,00 | ||
P2277.9501 | Influenza A MP (58-66) HLA-A*02:01 GILGFVFTL Influenza A matrix protein (58-66) - GILGFVFTL. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes... | 116,00 | ||
P2276.9501 | Influenza A NP (366-374) - ASNENMETM Influenza A NP (366-374) - ASNENMETM. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by... | 116,00 | ||
P2280.9501 | LCMV GP (33-41) KAVYNFATM LCMV GP (33-41) with the peptide sequence KAVYNFATM is a T-cell epitope peptide which is normally presented presented on the surface of antigen-presenting... | 116,00 | ||
C6467.0800 | LH - Luteinizing Hormone from procine Porcine Luteinizing Hormone is a glycosylated, polypeptide chain which stimulates maturation of follicle, induces ovulation, accelerates formation of corpus... | 122,00 | ||
S5053.0001 | Lysozyme from chicken egg white, min. 20000 U/mg - Molbio Grade Lysozyme (Muramidase) preferentially hydrolyses the β-1,4-glycosidic binding between N-Acetyl muraminic acid and N-Acetyl glucosamine, a component of the... | 45,32 | ||
S5237.0005 | Lysozyme from chicken egg, ca. 20000 U/mg The enzyme Lysozyme (N-Acetylmuramide glycanhydrolase) affects cell walls of bacteria. In molecular biology, the enzyme from chicken white egg is used to... | 76,31 | ||
P2966.9505 | MAGE-A3 (112-120) HLA-A*02:01 KVAEELVHFL - alternative sequence MAGE-A3 (112-120) HLA-A*02:01 KVAEELVHFL belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting... | 80,63 | ||
P2965.9505 | MAGE-A3 (112-120) HLA-A*02:01 KVAELVHFL MAGE-A3 (112-120) HLA-A*02:01 KVAELVHFL belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting... | 76,00 | ||
P2282.9501 | MAGE-A3 (271-279) HLA-A*02:01 FLWGPRALV MAGE-A3 (271-279) HLA-A*02:01 FLWGPRALV antigen belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of... | 116,00 | ||
P2965.70PP | MAGE-A3 Peptide Pool MAGE-A3 Control Pool of 76peptides derived from a peptide scan (15mers with 11 aa overlap) through Melanoma-associated antigen 3 (MAGEA3) (UniProt ID:... | 225,00 | ||
P2969.9505 | MAGE-A4 (230–239) HLA-A*02:01 GVYDGREHTV MAGE-A4 (230–239) HLA-A*02:01 GVYDGREHTV belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting... | 80,63 | ||
P2271.9501 | MBP (1-11) human - Ac-ASQKRPSQRHG MBP (1-11) human - ASQKRPSQRHG represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the... | 116,00 | ||
P2272.9501 | MBP (54-72) human - SHHAARTTHYGSLPQKSQR MBP (54-72) human - SHHAARTTHYGSLPQKSQR represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously... | 232,00 | ||
P2974.9505 | Melan-A / MART-1 (26-35) - EAAGIGILTY - B*35:01 T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically... | 80,00 | ||
P2281.9501 | Melan-A / MART-1 (26-35) EAAGIGILTV - A*02:01 T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically... | 116,00 | ||
P2270.9501 | MOG (183-191) FVIVPVLGP MOG (183-191) FVIVPVLGP represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune... | 116,00 | ||
P2266.9501 | MOG (35-55) human - MEVGWYRPPFSRVVHLYRNGK The MOG peptide fragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) induces experimental autoimmune encephalomyelitis in rodents. A... | 178,23 | ||
P2265.9501 | MOG (35-55) rat/mouse MEVGWYRSPFSRVVHLYRNGK The MOG peptide fragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment) induces experimental autoimmune encephalomyelitis similar MS in rodents. | 168,00 | ||
P3025.9505 | MOG (35-55) rat/mouse MEVGWYRSPFSRVVHLYRNGK - Acetate The MOG peptide fragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment) induces experimental autoimmune encephalomyelitis similar MS in rodents. | 374,63 | ||
P2264.9501 | MOG (91-108), rat SDEGGYTCFFRDHSYQEE MOG (91-108) SDEGGYTCFFRDHSYQEE represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of... | 232,00 | ||
P2267.9501 | MOG (92-106) DEGGYTCFFRDHSYQ MOG (92-106) DEGGYTCFFRDHSYQ represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the... | 168,00 | ||
P2268.9505 | MOG (97-108) TCFFRDHSYQEE MOG (97-108) TCFFRDHSYQEE represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the... | 168,00 | ||
P3052.9505 | MUC-1 (12-20) HLA-A*02:01 LLLLTVLTV MUC-1 (12-20) HLA-A*02:01 LLLLTVLTV belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells... | 93,43 | ||
P3053.9505 | MUC-1 (13-21) HLA-A*02:01 LLLTVLTVV MUC-1 (13-21) HLA-A*02:01 LLLTVLTVV belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells... | 93,43 | ||
P2286.9501 | Nona arginine - Arg9 (R9) Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable... | 116,00 | ||
P2781.0080 | Omicron Variant B.1.1.529 Peptide Pool SARS-CoV-2 (Spike Glycoprotein) This peptide pool with 80 peptides covers all mutations in the Spike Glycoprotein derived from the omicron variant B.1.1.529 of SARS-CoV-2. | 283,25 | ||
P2275.9501 | Ova (257-264) SIINFEKL Ovalbumin (257-264) chicken has been used to trigger T cell activation in immunology studies.. T cell epitopes are presented on the surface of... | 116,00 | ||
P3286.9505 | Ova (257-264) SIINFEKL amide Ovalbumin (257-264) chicken has been used to trigger T cell activation in immunology studies.. T cell epitopes are presented on the surface of... | 116,00 | ||
P2283.9501 | Ova (323-339) ISQAVHAAHAEINEAGR T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically... | 148,53 | ||
P3287.9505 | Ova (323-339) ISQAVHAAHAEINEAGR - amide T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically... | 111,24 | ||
P3288.9501 | Ova (323-339) ISQAVHAAHAEINEAGR - amide T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically... | 116,70 | ||
M3177.0250 | Ovalbumin (crude) Albumin from chicken egg (Ovalbumin). Crude: min. 80% protein. | 79,57 | ||
P3094.9505 | p53 (264-272) HLA-A*0201 LLGRNSFEV | 108,75 | ||
P3093.9505 | p53 (264-272) HLA-A*0201 LLGRNSFEV | 108,75 | ||
P2284.9501 | PADRE - AKFVAAWTLKAAA pan HLA DR-binding epitope (PADRE) has been proposed as a simple carrier epitop. This mechanism ensures that cells infected by viruses or intracellular... | 148,53 | ||
S5239.0100 | Pancreatin Pancreatin is an complex enzymatic mixture of active ingredients that are obtained from the pancreas of domestic pigs. | 49,97 | ||
S5240.0025 | Papain from Carica papaya Papain is a member of the class of proteolytic enzymes that needs a free sulfhydryl group for activity (group of the cysteine proteases). The pH optimum of... | 67,00 | ||
S5241.0025 | Pepsin (EC 3.4.23.1) Pepsin from pig stomach. Its inactive precursor is the pepsinogen secreted by the main cells of the gastric mucosa. Pepsinogen is cleaved at acidic pH below... | 53,79 | ||
P2262.7005 | Peptide: NYSKMIFSHHHH Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta... | 163,46 | ||
P2273.9501 | PLP (139-151) - HCLGKWLGHPDKF PLP (139 - 151) - HCLGKWLGHPDKF represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of... | 160,68 | ||
P2274.9501 | PLP (178-191) - NTWTTCQSIAFPSK PLP (178-191) - NTWTTCQSIAFPSK represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the... | 148,00 | ||
P3118.9505 | PRAME (100-108) HLA-A*0201 VLDGLDVLL PRAME (100-108) HLA-A*0201 VLDGLDVLL for stimulation of human Prame (100-108) specific CD8+ T cells. The peptide is synthesised as it is presented by the MHC... | 108,75 | ||
P3120.9505 | PRAME (301-309) HLA-A24 LYVDSLFFL PRAME (100-108) HLA-A*0201 VLDGLDVLL for stimulation of human Prame (100-108) specific CD8+ T cells. The peptide is synthesised as it is presented by the MHC... | 108,75 | ||
C6380.0001 | rec. Human Serum Albumin (rHSA) Synonyms: Serum albumin, ALB, PRO0883, PRO0903, PRO1341, DKFZp779N1935, GIG20, GIG42, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696, SA, HSA. | 583,50 | ||
M6380.0001 | rec. Human Serum Albumin (rHSA) - from rice grain Synonyms: Serum albumin, ALB, PRO0883, PRO0903, PRO1341, DKFZp779N1935, GIG20, GIG42, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696, SA, HSA. | 382,13 | ||
M6384.0010 | rec. Human Serum Albumin (rHSA) - lipid-free Synonyms: Serum albumin, ALB, PRO0883, PRO0903, PRO1341, DKFZp779N1935, GIG20, GIG42, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696, SA, HSA. | 249,31 | ||
S5197.0500 | rec. L-Asparaginase L-Asparaginase. L-Asparaginase is an enzyme that depletes L-Asparagine an important nutrient for cancer cells resulting in cancer/tumor cell starvation.... | 201,96 | ||
S5344.0100 | recombinant human ACE2 Protein (ECD), Avi/His-Tag, non-biotinylated reombinant human ACE2 Protein (ECD. processed) contains an Avi/His-Tag, and is ready for invitro biotinylation, We offer high purity. and quality in HEK293... | Peptides and Proteins | 722,95 | |
S5201.0001 | recombinant Lysostaphin - EC 3.4.24.75 Recombinant Lysostaphin. Synonyms: EC 3.4.24.75, Glycyl-glycine endopeptidase. | 180,25 | ||
P3139.9505 | RHAMM (165-173) HLA-A*0201 ILSLELMKL RHAMM peptide ILSLELMKL (HLA-A*0201) for stimulation of human RHAMM -specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I... | 108,75 | ||
C6461.0010 | rhCG - Corticotropin releasing hormone binding protein CRH is a powerful stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. CRH concentration in the human peripheral circulation is... | 140,69 | ||
S5558.0100 | rHu EpCAM - 100 µg Epithelial Cell Adhesion Molecule (EpCAM) also known as antigen GA733-2 is a 40 kDa transmembrane glycoprotein . It´s composed of a 242 aa extracellular... | 525,00 | ||
S5557.0100 | rHu HER2-ECD / ErbB2/Her2 This protein family members (ErbB1-4) serve as receptors for epidermal growth factor. ErbB2 is found on the on the surface of epithelial cells and strongly... | 618,33 | ||
S5553.0100 | rHu Vitronectin Recombinant human vitronectin (rhnVN) from Genaxxon is a recombinant human protein that provides a defined surface for feeder-free culture of all sorts of... | 246,49 | ||
C6499.0100 | rhuPTH - recombinant human Parathyroid Hormon (aa 1-34) Parathyroid hormone (PTH), or parathormone, is secreted by the parathyroid glands as a polypeptide of 84 amino acids. It acts to increase the concentration... | 318,80 | ||
P2257.7005 | RIIGL - Inhibitor Peptide of amyloid-ß RIIGL is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the... | 163,20 | ||
P3143.9505 | RSV NP (137-145) HLA-A*02:01 KMLKEMGEV RSV NP (137-145) HLA-A*02:01 KMLKEMGEV is a linear peptidic epitope (epitope ID32357) studied as part of Nucleoprotein from Human respiratory syncytial... | 108,75 | ||
P4000.9501 | SARS-CoV SSp-1 A2 (HLA-A*02:01) - RLNEVAKNL RLNEVAKNL SARS-CoV SSp-1 A2 (HLA-A*02:01) | 106,25 | ||
S5333.0100 | SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilized Trimer The engineered recombinant Sars-Co-V-2 Spike S1 protein contains specific amino acid substitutions to stabilize the prefusion conformation (2P). Furthermore,... | Peptides and Proteins | 588,16 | |
S5348.0100 | SARS-CoV-2 (COVID-19) Nucleocapsid protein - (1-419), His-Tag Beneath its envelope membrane, the new coronavirus SARS-CoV-2 consists of a icosaedric nucleocapsid that contains its genectic information in form of... | Peptides and Proteins | 513,71 | |
P4015.0102 | SARS-CoV-2 (N-Protein) - Peptide Pool Peptide pool of 102 overlapping peptides of the Nucleoprotein of SARS-CoV-2. The peptide pools is derived from a peptide scan (15mers with 11 aa overlap -... | 262,65 | ||
P4014.0316 | SARS-CoV-2 (Spike Glycoprotein) Peptide Pool - 316 peptides SARS-CoV-2 (Spike Glycoprotein) Peptide Pool of 316 overlapping peptides (delivered in two subpools of 158 & 158 peptides) derived from a peptide scan... | 592,25 | ||
S5347.0050 | SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.)... | Peptides and Proteins | 250,64 | |
S5346.0050 | SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (800-1000 a.a.)... | Peptides and Proteins | 250,64 | |
S5343.0050 | SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic - with His-Tag SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and... | Peptides and Proteins | 250,64 | |
S5341.0050 | SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag... | Peptides and Proteins | 1108,38 | |
P4005.9501 | SARS-CoV-2 Membrane GP A2 (61-70) TLACFVLAAV SARS-CoV-2 Membrane GP A2 TLACFVLAAV with amino acids 61-70 of the Membrane GP A2 protein is an antigen-specific SARS-CoV-2 peptide. | 106,25 | ||
S5342.0050 | SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc... | Peptides and Proteins | 1108,38 | |
P4007.9501 | SARS-CoV-2 Nucleocapsid _1 B7 FPRGQGVPI SARS-CoV-2 Nucleocapsid _1 B7 FPRGQGVPI is an antigen-specific SARS-CoV-2 peptide. | 106,25 | ||
P4008.9501 | SARS-CoV-2 Nucleocapsid _2 B7 SPRWYFYYL SARS-CoV-2 Nucleocapsid _2 B7 SPRWYFYYL is an antigen-specific SARS-CoV-2 peptide. | 106,25 | ||
P4009.9501 | SARS-CoV-2 Nucleocapsid _3 B7 KPRQKRTAT SARS-CoV-2 Nucleocapsid _3 B7 KPRQKRTAT is an antigen-specific SARS-CoV-2 peptide. | 106,25 | ||
P4001.9501 | SARS-CoV-2 Nucleocapsid A2 (138-146) - ALNTPKDHI SARS-CoV-2 Nucleocapsid A2 peptide with amino acids 138-146 (ALNTPKDHI) | 106,25 | ||
P4003.9501 | SARS-CoV-2 Nucleocapsid A2 (219-227) LQLPQGTTL SARS-CoV-2 Nucleocapsid A2 peptide LQLPQGTTL with amino acids 219-227 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide. | 106,25 | ||
P4004.9501 | SARS-CoV-2 Nucleocapsid A2 (226-234) LALLLLDRL SARS-CoV-2 Nucleocapsid A2 peptide with amino acids 226-234 (LALLLLDRL) | 106,25 | ||
P4002.9501 | SARS-CoV-2 Nucleocapsid A2 (316-324) GMSRIGMEV SARS-CoV-2 Nucleocapsid A2 peptide GMSRIGMEV with amino acids 316-324 is an antigen-specific SARS-CoV-2 peptide. | 106,25 | ||
P4006.9501 | SARS-CoV-2 Nucleocapsid A2 (N223-231) LLLDRLNQL SARS-CoV-2 Nucleocapsid A2 peptide with amino acids N223-231 (LLLDRLNQL) | 106,25 | ||
S5334.0100 | SARS-CoV-2 Spike S1 Protein (RBD) - without Tag SARS-CoV-2 Spike Protein RBD Recombinant without His-tag is a recombinant protein that is in liquid form buffered in PBS. This protein was produced... | Peptides and Proteins | 304,62 | |
S5340.0100 | SARS-CoV-2 Spike S1 Protein (RBD) with His-Tag SARS-CoV-2 Spike Protein RBD Recombinant with C-terminal His-tag is a recombinant protein that is in liquid form buffered in PBS. This protein was produced... | Peptides and Proteins | 384,31 | |
P4010.9501 | SARS-CoV-2 Surface GP A2 (1000-1008) - YLQPRTFLL SARS-CoV-2 Surface A2 peptide with amino acids YLQPRTFLL | 131,25 | ||
P4011.9501 | SARS-CoV-2 Surface GP_1 A1 (865-873) - LTDEMIAQY SARS-CoV-2 Nucleocapsid A1 peptide with amino acids LTDEMIAQY | 106,25 | ||
P4012.9501 | SARS-CoV-2 Surface GP_1 A3 (378-386) - KCYGVSPTK SARS-CoV-2 Nucleocapsid A3 peptide with amino acids KCYGVSPTK | 285,00 | ||
P3144.9505 | SART3 (309-317) HLA-A*02:01 RLAEYQAYI | 108,75 | ||
S5367.1100 | Serratia Nuclease - 100000 IU Serratia nuclease is a non-specific enzyme that cleaves all forms of DNA and RNA very efficiently. It is commonly used on biological material for the... | 656,84 | ||
S5366.1000 | TEV Protease from Tobacco Etch Virus - min. 95% pure TEV-protease is a highly site-specific cysteine protease that is found in the Tobacco Etch Virus (TEV). The Genaxon TEV protease comes with an N-terminal... | 179,93 | ||
M6077.0005 | Trypsin from bovine pancreas Trypsin from bovine pancreas, Tryptic activity (BAEE): min. 2500 U/mg. Lyophilised. No P. aeruginosa, Salmonella, Staphyloccus aureus detectable. Synonym:... | 358,00 | ||
C4264.0025 | Trypsin powder from porcine pancreas (1:250) The native form of Trypsin consists of a single chain polypeptide of 223 amino acid residues, produced by the removal of the N-terminal hexapeptide from... | 128,87 | ||
P3175.9505 | Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV for stimulation of T-cells. The single peptide (YMDGTMSQV) is used for stimulation of human gp100-specific... | 108,75 | ||
P3176.9505 | Tyrosinase (425-434) HLA-A*03:01 YMVPFIPLYR Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV for stimulation of T-cells. The single peptide (YMDGTMSQV) is used for stimulation of human gp100-specific... | 108,75 | ||
P4016.0025 | Variant B.1.617.1 (Kappa ) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) Peptide pool with 25 peptides covers all mutations in the Spike Glycoprotein derived from the kappa variant B.1.617.1 of SARS-CoV-2 which emerged in India in... | 262,65 | ||
P4013.0027 | Variant B.1.617.2 (Delta) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) The Variant B.1.617.2 (Delta) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) with 27 peptides covers all mutations in the Spike Glycoprotein derived from the... | 262,65 | ||
P2784.0315 | Variant Omicron B.1.1.529 BA.5 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein) This peptide pool of the omicron variant B.1.1.529 BA.5 of SARS-CoV-2 (315 peptides, delivered in two subpools of 158 & 157 peptides) that covers the whole... | 836,58 | ||
P2780.0315 | Variant Omicron B.1.1.529 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein) This peptide pool of the new omicron variant of SARS-CoV-2 (315 peptides, delivered in two subpools of 158 & 157 peptides) that covers the whole spike... | 836,58 | ||
C4366.0500 | Zymolyase(R) -100T Zymolyase®, produced by a submerged culture of Arthrobacter luteus, has strong lytic activity against living yeast cell walls to produce protoplast or... | 802,15 | ||
C4352.0001 | Zymolyase(R) -20T Zymolyase®, produced by a submerged culture of Arthrobacter luteus, has strong lytic activity against living yeast cell walls to produce protoplast or... | 297,41 | ||
P2305.9501 | α-Defensin 5 human - ATCYCRTGRCATRESLSGVCEISGRLYRLCCR α-Defensin 5 (peptide sequence: ATCYCRTGRCATRESLSGVCEISGRLYRLCCR) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a... | 720,00 |
1
HBV core 19-27 CMV pp65 HBV HBsAg Collagenase Collagenase MUC-1 12-20 alpha-Chymotryp hGHRP-2 Human HIV TAT 48-60 Melan-A MART-1 Melan-A MART-1 human LL-37 rec. Ova 257-264 EBV EBNA-3A MBP 54-72 human human LL-37 Bovine Serum gp100 280-288 Collagenase HCV NS3 CMV pp65 16-24 Ova 323-339 MAGE-A3 112-120 EBV LMP-2 HER-2 neu Ova 257-264 MAGE-A4 230 239 Tyrosinase HBV Polymerase MBP 1-11 human HCMVA pp65 human FSH - CMV IE-1 99-107 p53 264-272 D-Lys3 -GHRP-6 HBV HBsAg Collagenase HIV-1 TAT 47-57 gp100 154-162 Leu27 - Melan-A HER-2 neu 63-71 PRAME 301-309 Trypsin powder p53 264-272 HPV 16 E7 49-57