Peptides & Proteins

... for research on e.g. Covid-19, Alzheimer, Multiple Sclerosis, Apoptosis or Cancer

The current COVID-19 outbreak generates an urgent demand for SARS-CoV-2 related products enabling definition of immune-relevant antigens and identification of B- and T-cell epitopes, development of immune-therapeutic strategies and tools for antigen specific immune monitoring. In response, GENAXXON is offering now a SARS-CoV-2 glycoprotein responsible for membrane fusion and is therefore required for virus entry and cell fusion. 

You can order this protein through our shop: S5340.0100 > 
or request a quote. 
To be able to optimally allocate our capacities, we highly appreciate your feedback on your anticipated needs for larger amounts, or higher purities.

Further information in our flyer >

Peptides and Proteins for research on Covid-19 - Alzheimer - Multiple Sclerosis - Apoptosis - Cancer
GENAXXON bioscience offers peptides from various research areas
as readily available in-stock peptides >

These catalogue peptides come from the research fields: lipopeptides, MHC peptides, MS peptides, Alzheimer peptides / neuroscience, cancer & apoptosis and cell penetrating peptides (CPP).

Of course, we also synthesize peptides on customer request.
As a DIN ISO 9001-2015 certified company, e offer our customers the highest quality in the peptides we supply. The product portfolio includes standard peptides with a purity of 70% to >95% and from 1mg up to 1g, but also isotopic labeled peptides, immunogenic peptides, peptides with post-translational modifications, peptides with a fluorescent label, biotin or other modifications.

For our customers working in the field of Alzheimer´s Disease, Multiple Sclerosis or immunogenic defects , we offer from stock high quality peptides like: Cell Penetrating Peptides >,
MHC-I and MCH-II Peptides >, Peptides for Alzheimer´s Disease > oder or Multiple Sclerosis > research. For details please search our online catalogue.

Besides the above mentioned peptides,GENAXXON offers a wide range of Lipopeptides >, as part of the outer membrane of Gram negative bacteria, Gram positive bacteria and mycoplasma, acting as cell activation signal via toll like receptors are offered by Genaxxon bioscience as purified products that can be ordered from stock.

 

 

... for research on e.g. Covid-19, Alzheimer, Multiple Sclerosis, Apoptosis or Cancer The current COVID-19 outbreak generates an urgent demand for SARS-CoV-2 related products... read more »
Close window
Peptides & Proteins

... for research on e.g. Covid-19, Alzheimer, Multiple Sclerosis, Apoptosis or Cancer

The current COVID-19 outbreak generates an urgent demand for SARS-CoV-2 related products enabling definition of immune-relevant antigens and identification of B- and T-cell epitopes, development of immune-therapeutic strategies and tools for antigen specific immune monitoring. In response, GENAXXON is offering now a SARS-CoV-2 glycoprotein responsible for membrane fusion and is therefore required for virus entry and cell fusion. 

You can order this protein through our shop: S5340.0100 > 
or request a quote. 
To be able to optimally allocate our capacities, we highly appreciate your feedback on your anticipated needs for larger amounts, or higher purities.

Further information in our flyer >

Peptides and Proteins for research on Covid-19 - Alzheimer - Multiple Sclerosis - Apoptosis - Cancer
GENAXXON bioscience offers peptides from various research areas
as readily available in-stock peptides >

These catalogue peptides come from the research fields: lipopeptides, MHC peptides, MS peptides, Alzheimer peptides / neuroscience, cancer & apoptosis and cell penetrating peptides (CPP).

Of course, we also synthesize peptides on customer request.
As a DIN ISO 9001-2015 certified company, e offer our customers the highest quality in the peptides we supply. The product portfolio includes standard peptides with a purity of 70% to >95% and from 1mg up to 1g, but also isotopic labeled peptides, immunogenic peptides, peptides with post-translational modifications, peptides with a fluorescent label, biotin or other modifications.

For our customers working in the field of Alzheimer´s Disease, Multiple Sclerosis or immunogenic defects , we offer from stock high quality peptides like: Cell Penetrating Peptides >,
MHC-I and MCH-II Peptides >, Peptides for Alzheimer´s Disease > oder or Multiple Sclerosis > research. For details please search our online catalogue.

Besides the above mentioned peptides,GENAXXON offers a wide range of Lipopeptides >, as part of the outer membrane of Gram negative bacteria, Gram positive bacteria and mycoplasma, acting as cell activation signal via toll like receptors are offered by Genaxxon bioscience as purified products that can be ordered from stock.

 

 

Close filters
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
 
from to
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
No results were found for the filter!
Prod.Nr. Description     Price €
P2351.9501 [Ala13] Apelin QRPRLSHKGPMPA 
Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as the heart, lung,...
140,00
P2358.9501 [Ala9] Autocamtide 2 - KKALRRQEAVDAL 
146,25
P2359.9501 [alpha]-Bag Cell Peptide (1 - 7) - APRLRFY 
Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia (1). They trigger a series of...
100,00
P2361.9501 [alpha]-Bag Cell Peptide (1 - 9) - APRLRFYSL 
Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia (1). They trigger a series of...
100,00
P2304.9505 [beta]-Amyloid (10-20) - YEVHHQKLVFF 
[beta]-Amyloid (10-20) (peptide sequence: YEVHHQKLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-42 peptide....
249,31
P2429.9505 [beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS 
Amino acid sequence RERMS represents the active domain of amyloid beta/A4 protein precursor that promotes fibroblast growth; H. Ninomiya, et al.; J. Cell....
103,27
P2432.9505 [beta]-Bag Cell Peptide - RLRFH 
Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk Aplysia (1). They trigger a series of...
85,50
C6472.0005 [D-Lys3]-GHRP-6 
[D-Lys3]-GHRP6 (growth hormone releasing peptide 6) induces the secretion of growth hormone (GH). In the membrane of clonal GC somatotropes, this peptide...
122,94
P2470.9505 [Des-octanoyl]-Ghrelin, human GSSFLSPEHQRVQQRKESKKPPAKLQPR 
Ghrelin is a peptide hormone of 28 amino acids. The third amino acid serine of the natural ghrelin is modified with octanoic acid. This modification is...
318,25
P2471.9505 [Des-octanoyl]-Ghrelin, rat GSSFLSPEHQKAQQRKESKKPPAKLQPR 
Ghrelin is a peptide hormone of 28 amino acids. The third amino acid serine of the natural ghrelin is modified with octanoic acid. This modification is...
318,25
P2493.9505 [Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR 
[Glu10]-ACTH (1-17), human SYSMEHFRWEKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone ACTH/Adrenocorticotropic...
238,00
P2508.9501 [Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV 
[Leu27] - Melan-A / MART-1 (26-35) - ELAGIGILTV - (HLA-A*02:01) an analog of Melan-A, with Leu substituted for Ala at position 27, shows better HLA-A*0201...
74,16
P2526.9505 [Phe17] Apelin KFRRQRPRLSHKGPMPF 
Apelin (also known as APLN) is a peptide that in humans is encoded by the APLN gene. It is widely expressed in various organs such as the heart, lung,...
226,10
P2300.9501 3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK 
The DYKDDDDK peptide was developed specifically for immunoaffinity chromatography. The peptide allows the competitive elution of proteins (amino terminal,...
246,13
P2589.9505 Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR 
Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR is a synthetic peptide according to the first 17 amino acids of the human hormone ACTH/Adrenocorticotropic...
238,00
P2256.7005 Ac-KLVFF-NH2 
Ac-KLVFF-NH2 is the N-terminal and C-terminal modified form of the amyloid-beta (16-20) inhibitor peptid KLVFF. The modification leads to higher stability...
163,46
P2598.9505 ACTH (1-10), human SYSMEHFRWG 
ACTH (1-10), human SYSMEHFRWG is a synthetic peptide according to the first 10 amino acids of the human hormone ACTH/Adrenocorticotropic hormone....
72,00
P2599.9505 ACTH (1-16), human SYSMEHFRWGKPVGKK 
ACTH (1-16), human SYSMEHFRWGKPVGKK is a synthetic peptide according to the first 16 amino acids of the human hormone ACTH/Adrenocorticotropic hormone....
238,00
P2612.9505 ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF 
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the first 39 amino acids of the human hormone...
441,75
P2603.9505 ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF 
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the amino acids 18 to 39 of the human hormone ACTH/Adrenocorticotropic...
261,25
P2607.9505 ACTH (4-10), human MEHFRWG 
ACTH (4-10), human MEHFRWG is a synthetic peptide according to the amino acids 4 to 10 of the human hormone ACTH/Adrenocorticotropic hormone....
85,50
M3105.0005 Albumin from hen egg white - Ovalbumin 
Albumin from chicken egg white (Ovalbumin). Min. 90% protein.
226,29
S5228.0001 alpha-Chymotrypsin (EC 3.4.21.1) 
α-Chymotrypsin is a serine peptidase that hydrolyzes peptide bonds with aromatic or large hydrophobic side chains (Tyr, Trp, Phe, Leu) on the carboxyl end of...
71,15
P2424.9505 Amyloid-beta (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA 
[beta]-Amyloid (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the...
708,50
P2255.9505 Amyloid-beta (16-20) KLVFF inhibitor peptide of Amyloid-beta 
The KLVFF peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived...
103,27
P2259.7005 Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ 
Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ. Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified...
224,58
P2291.9505 Antennapedia (43-58) penetratin 
Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie...
206,00
C6453.0005 Antide Acetate 
Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s body to represses FSH and LH releases that stem from the...
192,33
M3100.0005 Bovine albumin crystallized, free of fatty acid, free of globulin 
Crystallised Albumin is the purest form of the GENAXXON bovine albumins. It contains no crystallisation agents or other contaminants.
112,88
M3101.0050 Bovine albumin for EIA and RIA 
Compatible with many diagnostic enzymes and components. Primarily monomeric albumin. IgG not detectable
61,54
M3103.0025 Bovine albumin Fraction V (pH 7.0) 
Lyphilisiertes Albumin (Standardreinheit). Serumalbumin vom Rind (BSA) wird häufig zur Stabilisierung von Proteinen den entsprechenden Puffern zugesetzt. Die...
73,13
M3104.0050 Bovine Serum Albumin, very low endotoxin, no IgG 
Heat treated (equivalent to 10 hours at 60°C). IgG not detectable. Free of mycoplasma and bovine viruses. Free from capryllic acid or other stabilisers that...
86,05
P2655.9505 CD20 188-196 (HLA-A*02:01) HLA-A*02:01 SLFLGILSV 
85,50
P2659.9505 CD22-4 (371-379) HLA-A*02:01 RLLGKESQL 
85,50
S5230.0005 Chymotrypsinogen A - Chymotrypsin precursor 
Chymotrypsinogen is the practically inactive "precursor" (proenzyme, or zymogen) of chymotrypsin. In order to be activated, chymotrypsinogen has to be...
407,31
P2669.9501 CMV IE-1 (199-207) - ELRRKMMYM 
CMV IE-1 ELRRKMMYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human...
72,00
P2909.9505 CMV IE-1 (316-324) (I1) HLA-A*02:01 ILEETSVML 
Antigen peptide IE (316-324) (I1) HLA-A*02:01 (ILEETSVML) for stimulation of antigen-specific T cells in T cell assay such as ELISPOT, ICS, cytotoxicity or...
76,00
P2775.9501 CMV IE-1 (316-324) HLA-A*0201 VLEETSVML 
CMV IE-1 (316-324) HLA-A * 0201 VLEETSVML for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. IE-1 stands for...
116,00
P2910.9505 CMV IE-1 (99-107) RIKEHMLKK 
IE-1 stands for immediate-early protein 1. CMV stands for human cytomgealovirus, HCMV for human cytomegalovirus or HPV human herpesvirus.
76,00
P2674.9505 CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY 
CMV pp50 (245-253) HLA-A*01:01 VTEHDTLLY zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von MHC-Klasse-I-Molekülen präsentiert wird....
85,50
P2676.9501 CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK 
CMV pp65 (16-24) HLA-A*11:01 GPISGHVLK for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for human...
72,00
P2678.9501 CMV pp65 (417-426) HLA-B*07:02 TPRVTGGGAM 
CMV pp65 (417-426) HLA-B * 07: 02 TPRVTGGGAM for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for...
108,75
P3282.9501 CMV pp65 (417-426), amid HLA-B*07:02 TPRVTGGGAM-NH2 
CMV pp65 (417-426) HLA-B * 07: 02 TPRVTGGGAM for stimulation of T cells. The peptide was synthesized as presented by MHC class I molecules. CMV stands for...
140,25
P2296.9501 CMV pp65 (495-503) HLA-A*02:01 NLVPMVATV 
Single peptide (NLVPMVATV) for stimulation of human CMV specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201...
116,00
C4255.0100 Collagenase Type I (EC 3.4.24.3) >100 units/mg 
Collagenase from Clostridium histolyticum lyophilised (>90 Mandl-Units / >90 CDU units/mg). Histolyticum clostridiopeptidase (EC 3.4.24.3). Natural balance...
82,34
C4341.0100 Collagenase Type II (EC 3.4.24.3) >180 units/mg 
Collagenase from Clostridium histolyticum lyophilised (>180 Mandl units / >180 CDU units). Histolyticum clostridiopeptidase (EC 3.4.24.3). Genaxxon...
82,34
C4346.2000 Collagenase Type III (EC 3.4.24.3) 
Collagenase from Clostridium histolyticum lyophilised (125 to 250 Mandl-Units). Histolyticum clostridiopeptidase (EC 3.4.24.3). Genaxxon Collagenase Typ III...
1405,69
C4310.0100 Collagenase Type IV (EC 3.4.24.3) >900 units/mg 
Collagenase from Clostridium histolyticum lyophilised (>900 Mandl units / >900 CDU units). Histolyticum clostridiopeptidase (EC 3.4.24.3). Enzyme mixture of...
103,00
P2252.0001 Control peptide Amyloid-beta (40-1) human 
Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42...
260,71
P2251.0001 Control peptide Amyloid-beta (40-1) rat 
Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42...
260,71
C6003.0050 Coronavirus 2019 Nucleocapsid Mosaic Protein 
The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused...
Peptides and Proteins 250,64
P2292.9501 CyLoP-1 peptide (CRWRWKCCKK) 
CPPs, such as CyloP-1, are generally taken up by endocytic pathways, with vesicular encapsulation being a limiting factor in intracellular targeting. CyLoP-1...
144,00
P2287.9501 D-Arg9 (r9) - Nona-D-Arginine 
CPPs are usually short peptides with less than 30 amino acids. They are mostly amphipathic and highly cationic and usually rich of the amino acids arginine...
311,25
P2302.7005 D-Arg9 (r9) - Nona-D-Arginine amidated C-terminus 
Nona-D-Arginine (r9, respective sequence: rrrrrrrrr-NH2) belongs to the group of cell penetrating peptide (CPPs) which are characterised by their ability to...
287,79
P2308.7005 D-Arg9 (r9) - Nona-D-Arginine modified termini 
CPPs are usually short peptides with less than 30 amino acids. They are mostly amphipathic and highly cationic and usually rich of the amino acids arginine...
287,79
P2289.9501 D-TAT (47-57) ygrkkrrqrrr-NH2 
Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen Makromolekülen wie...
296,13
P2258.7005 DWGKGGRWRLWPGASGKTEA - Inhibitor Peptide of amyloid-ß 
DWGKGGRWRLWPGASGKTEA peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified...
224,54
P2301.9501 EBNA-1 Protein (562-570) FMVFLQTHI 
The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo...
Peptides and Proteins 116,00
P2295.9501 EBV BMLF-1 280-288 (HLA-A*02:01) GLCTLVAML 
Single peptide (GLCTLVAML) for stimulation of humanEBV BMLF-1(280-288) CD8+ specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC...
116,00
P2695.9505 EBV BMRF1 (208-216) HLA-A*02:01 TLDYKPLSV 
The Epstein–Barr virus (EBV), formally called Human gammaherpesvirus 4, is one of eight known human herpesvirus types in the herpes family, and is one of the...
72,00
P2706.9505 EBV EBNA-1 (407-417) HLA-B*35:01 HPVGEADYFEY 
76,00
P2709.9505 EBV EBNA-3A (325-333) HLA-B*08:01 FLRGRAYGL 
76,00
P2285.9501 EBV EBNA-3A (379-387) HLA-B*07:02 RPPIFIRRL 
Single peptide (RPPIFIRRL) for stimulation of human EBV EBNA-3A (379-387) specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC...
116,00
P2720.9505 EBV LMP-2 (419-427) HLA-A*24:02 TYGPVFMCL 
EBV LMP-2 (419-427) HLA-A*24:02 TYGPVFMCL
76,00
P2723.9505 EBV LMP2 (131-139) HLA-A*24:02 PYLFWLAAI 
76,00
P2782.0014 Epsilon Variant (B.1.427/B.1.429) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) 
Peptide pool with 14 peptides that covers all mutations in the Spike Glycoprotein derived from the epsilon variant B.1.427/B.1.429 of SARS-CoV-2.
262,65
P2783.0031 Eta Variant (B.1.525) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) 
This peptide pool with 31 peptides covers all mutations in the Spike Glycoprotein derived from the eta variant B.1.525 of SARS-CoV-2 which emerged in Angola...
262,65
P2293.9501 FLAG-Peptide - DYKDDDDK 
The DYKDDDDK peptide was specifically designed for immunoaffinity chromatography. It allows elution under mild and non-denaturing conditions. Several...
140,00
P2261.7005 FYLKVPSSLHHHHGRDKLVFFHHHH 
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta...
213,89
P2751.9505 gp100 (154-162) HLA-A*02:01 KTWGQYWQV 
gp100 (154-162) HLA-A*02:01 KTWGQYWQV is a linear peptidic epitope (epitope ID 33915) studied as part of Melanocyte protein PMEL from Homo sapiens (human)....
116,00
P2757.9501 gp100 (280-288) HLA-A*02:01 YLEPGPVTA 
T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically...
78,00
C6470.1000 Growth-hormone-releasing hormone (GHRH) 
Human Growth Hormone Releasing Hormone (HuGHRH). The protein (1mg/mL) was lyophilized after extensive dialyses against 1.7mg sodium phosphate buffer (0.1mg...
174,45
P2763.9501 HBV core (117-125) (HLA-A*24:02) - EYLVSFGVW 
HBV core (117-125) (HLA-A*24:02) - EYLVSFGVW is a linear peptidic epitope (epitope ID15061) studied as part of Capsid protein from Hepatitis B virus and...
109,13
P2764.9501 HBV core (18-27) (HLA-A*02:01) - FLPSDFFPSV 
HBV core (18-27) (HLA-A*02:01) - FLPSDFFPSV is a linear peptidic epitope studied as part of Capsid protein from Hepatitis B virus and External core antigen...
109,13
P2765.9501 HBV core (18-27) (subtype ADR4) (HLA-A*02:01) - FLPSDFFPSI 
HBV core (18-27) (subtype ADR4) (HLA-A*02:01) - FLPSDFFPSI is a linear peptidic epitope (epitope ID16832) studied as part of External core antigen from...
109,13
P2766.9501 HBV core (19-27) (HLA-B*35:01) (HLA-B*51:01) - LPSDFFPSV 
HBV core (19-27) (HLA-B*35:01) (HLA-B*51:01) - LPSDFFPSV is a linear peptidic epitope (epitope ID38701) studied as part of Capsid protein from Hepatitis B...
109,13
P2767.9501 HBV core antigen (88-96) (HLA-A*11:01) - YVNVNMGLK 
HBV core antigen (88-96) (HLA-A*11:01) YVNVNMGLK is a linear peptidic epitope (epitope ID76370) studied as part of Capsid protein from Hepatitis B virus and...
109,13
P2768.9501 HBV envelope (183-191) (HLA-A*02:01) - FLLTRILTI 
HBV envelope (183-191) (HLA-A*02:01) - FLLTRILTI is a linear peptidic epitope (epitope ID16755) studied as part of Large envelope protein from Hepatitis B...
109,13
P2770.9505 HBV envelope (348-357) (HLA-A*02:01) - GLSPTVWLSV 
Antigen Peptide HBV envelope 348-357 (HLA-A*02:01) GLSPTVWLSV for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity...
72,00
P2772.9505 HBV HBsAg (190-197) (H-2 Kb) - VWLSVIWM 
HBV HBsAg (190-197) (H-2 Kb) - VWLSVIWM is a linear peptidic epitope (epitope ID71948) studied as part of Large envelope protein from Hepatitis B virus. This...
72,00
P2771.9505 HBV HBsAg (371-378) (H2-Kb) - IVSPFIPL 
HBV HBsAg (371-378) (H2-Kb) - IVSPFIPL is a linear peptidic epitope (epitope ID29454) studied as part of Large envelope protein from Hepatitis B virus. This...
72,00
P2762.9501 HBV Polymerase (455-463) (HLA-A*02:01) - GLSRYVARL 
HBV Polymerase (455-463) (HLA-A*02:01) - GLSRYVARL is a linear peptidic epitope (epitope ID21145) studied as part of the Hepatitis B virus polymerase. This...
109,13
P2678.0138 HCMVA (pp65) Peptide Pool 
Control Pool of 138 peptides derived from a peptide scan (15mers with 11 aa overlap) through 65 kDa phosphoprotein (pp65) (UniProtKB - P06725) of Human...
265,00
P2799.9505 HCV NS3 (1406-1415) (HLA-A*02:01) KLSGLGINAV 
108,75
P2279.9501 HCV NS5B (2594-2602) HLA-A*02:01 ALYDVVTKL 
We identified a relatively high degree of amino acid sequence similarity between HLA-A2-restricted epitopes HIV (HXB2) gag: 77-85 (SLYNTVATL: SL9) and HCV...
123,06
C4306.0001 Heparin sodium salt from porcine intestinal mucosa 
Heparin is mainly responsible for delayed blood clotting. It enhances the antithrombin-mediated inactivation of proteases in the clotting pathway. Therefore,...
129,07
P2814.9501 HER-2/neu (369-377) HLA-A*02:01 KIFGSLAFL 
HER-2/neu (369-377) HLA-A*02:01 KIFGSLAFL. HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or...
72,00
P2813.9505 HER-2/neu (434-443) HLA-A*02:01 ILHDGAYSL 
HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL. HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or...
108,75
P2815.9505 HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL 
HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL. HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or...
72,00
P2816.9501 HER-2/neu (63-71) HLA-A*24:02 TYLPTNASL 
HER-2/neu (435-443) HLA-A*02:01 ILHNGAYSL. HER2 is the abbreviation for "human epidermal growth factor receptor 2". HER2 is often referred to as erbB2 or...
72,00
C6471.0025 hGHRP-2 / Human Growth Hormone Releasing Peptide-2 
GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs to stimulate GH release. GHRP-2, an...
140,69
P2306.9501 Histatin 5: DSHAKRHHGYKRKFHEKHHSHRGY 
Histatin 5 (peptide sequence: DSHAKRHHGYKRKFHEKHHSHRGY) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a broad...
225,00
P2837.9505 HIV Gag (50-59) HLA-A*02:01 SLFNTVATLY 
HIV-1 p17 Gag (77-85) SLYNTVATL belongs to the T-Zell-Epitop-Peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC...
72,00
P2846.9501 HIV Pol HLA-A*02:01 VIYHYVDDL 
108,75
P2290.9501 HIV TAT (48-60) GRKKRRQRRRPPQ-NH2 (amide) 
Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable...
132,00
P2838.9505 HIV-1 Gag (77-85) HLA-A*02:01 SLFNTVATL 
HIV-1 Gag (77-85) HLA-A*02:01 SLFNTVATL belongs to the T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by...
72,00
P2278.9501 HIV-1 p17 Gag (77-85) HLA-A*02:01 SLYNTVATL 
HIV-1 p17 Gag (77-85) SLYNTVATL belongs to the T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells by MHC...
116,00
P2867.9501 HIV-1 RT (476-484) HLA-A*02:01 ILKEPVHGV 
The sequence ILKEPVHGV is part of the Gag-Pol polyprotein from Human immunodeficiency virus 1. The peptide is used for studies on HIV-1 and stimulation of...
108,75
P2288.9501 HIV-1 TAT (47-57) YGRKKRRQRRR-NH2 
Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable...
295,00
P2881.9501 HPV 16 E7 (49-57) H-2 Db RAHYNIVTF 
RAHYNIVTF represents the linear peptidic epitope studied as part of Protein E7 (Alphapapillomavirus 9) and other human papillomavirus protein. This epitope...
108,75
S5361.0100 human ACE2 Protein (ECD), Avi/His-Tag, biotinylated 
Recombinant human ACE2 protein (ECD. processed) contains an Avi/His tag and is biotinylated. We offer high purity. and quality in HEK293 expressed...
Peptides and Proteins 1090,55
S5349.0100 Human ACE2 recombinant protein.(ECD, processed), Tag-free 
Recombinant human ACE2 protein (ECD. processed) Tag-free, liquid formulation. We offer high purity. and quality in HEK293 expressed recombinant protein for...
Peptides and Proteins 722,95
C6468.0500 human FSH - Follicle stimulating Hormone 
In both males and females, FSH stimulates the maturation of germ cells. In females, FSH initiates follicular growth, specifically affecting granulosa cells....
153,83
P2955.9505 human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR 
LL-37 human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating...
241,40
P2299.9501 human LL-37 [LL-37, 37 aa] 
LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating...
Peptides and Proteins 252,49
S5233.0001 Hyaluronidase (EC 3.2.1.35) - min. 500 U/mg 
Hyaluronidase isolated from sheep testes. The mammalian glycolytic hyaluronidase (EC 3.2.1.35) catalyzes the hydrolysis of the 1-4 bond between...
262,65
P2307.9501 Indolicidin - ILPWKWPWWPWRR-NH2 
Indolicidin (peptide sequence: ILPWKWPWWPWRR-NH2) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a broad spectrum...
235,00
P2277.9501 Influenza A MP (58-66) HLA-A*02:01 GILGFVFTL 
Influenza A matrix protein (58-66) - GILGFVFTL. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes...
116,00
P2276.9501 Influenza A NP (366-374) - ASNENMETM 
Influenza A NP (366-374) - ASNENMETM. T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by...
116,00
P2280.9501 LCMV GP (33-41) KAVYNFATM 
LCMV GP (33-41) with the peptide sequence KAVYNFATM is a T-cell epitope peptide which is normally presented presented on the surface of antigen-presenting...
123,06
C6467.0800 LH - Luteinizing Hormone from procine 
Porcine Luteinizing Hormone is a glycosylated, polypeptide chain which stimulates maturation of follicle, induces ovulation, accelerates formation of corpus...
122,00
S5053.0001 Lysozyme from chicken egg white, min. 20000 U/mg - Molbio Grade 
Lysozyme (Muramidase) preferentially hydrolyses the β-1,4-glycosidic binding between N-Acetyl muraminic acid and N-Acetyl glucosamine, a component of the...
45,32
S5237.0005 Lysozyme from chicken egg, ca. 20000 U/mg 
The enzyme Lysozyme (N-Acetylmuramide glycanhydrolase) affects cell walls of bacteria. In molecular biology, the enzyme from chicken white egg is used to...
76,31
P2966.9505 MAGE-A3 (112-120) HLA-A*02:01 KVAEELVHFL - alternative sequence 
MAGE-A3 (112-120) HLA-A*02:01 KVAEELVHFL belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting...
80,63
P2965.9505 MAGE-A3 (112-120) HLA-A*02:01 KVAELVHFL 
MAGE-A3 (112-120) HLA-A*02:01 KVAELVHFL belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting...
76,00
P2282.9501 MAGE-A3 (271-279) HLA-A*02:01 FLWGPRALV 
MAGE-A3 (271-279) HLA-A*02:01 FLWGPRALV antigen belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of...
116,00
P2965.70PP MAGE-A3 Peptide Pool 
MAGE-A3 Control Pool of 76peptides derived from a peptide scan (15mers with 11 aa overlap) through Melanoma-associated antigen 3 (MAGEA3) (UniProt ID:...
225,00
P2969.9505 MAGE-A4 (230–239) HLA-A*02:01 GVYDGREHTV 
MAGE-A4 (230–239) HLA-A*02:01 GVYDGREHTV belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting...
80,63
P2271.9501 MBP (1-11) human - Ac-ASQKRPSQRHG 
MBP (1-11) human - ASQKRPSQRHG represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the...
116,00
P2272.9501 MBP (54-72) human - SHHAARTTHYGSLPQKSQR 
MBP (54-72) human - SHHAARTTHYGSLPQKSQR represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously...
232,00
P2974.9505 Melan-A / MART-1 (26-35) - EAAGIGILTY - B*35:01 
T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically...
80,00
P2281.9501 Melan-A / MART-1 (26-35) EAAGIGILTV - A*02:01 
T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically...
116,00
P2270.9501 MOG (183-191) FVIVPVLGP 
MOG (183-191) FVIVPVLGP represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the immune...
116,00
P2266.9501 MOG (35-55) human - MEVGWYRPPFSRVVHLYRNGK 
The MOG peptide fragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55) induces experimental autoimmune encephalomyelitis in rodents. A...
178,23
P2265.9501 MOG (35-55) rat/mouse MEVGWYRSPFSRVVHLYRNGK 
The MOG peptide fragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment) induces experimental autoimmune encephalomyelitis similar MS in rodents.
168,00
P3025.9505 MOG (35-55) rat/mouse MEVGWYRSPFSRVVHLYRNGK - Acetate 
The MOG peptide fragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment) induces experimental autoimmune encephalomyelitis similar MS in rodents.
374,63
P2264.9501 MOG (91-108), rat SDEGGYTCFFRDHSYQEE 
MOG (91-108) SDEGGYTCFFRDHSYQEE represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of...
232,00
P2267.9501 MOG (92-106) DEGGYTCFFRDHSYQ 
MOG (92-106) DEGGYTCFFRDHSYQ represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the...
168,00
P2268.9505 MOG (97-108) TCFFRDHSYQEE 
MOG (97-108) TCFFRDHSYQEE represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the...
168,00
P3052.9505 MUC-1 (12-20) HLA-A*02:01 LLLLTVLTV 
MUC-1 (12-20) HLA-A*02:01 LLLLTVLTV belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells...
93,43
P3053.9505 MUC-1 (13-21) HLA-A*02:01 LLLTVLTVV 
MUC-1 (13-21) HLA-A*02:01 LLLTVLTVV belongs to the group of T cell epitope peptides. T cell epitopes are presented on the surface of antigen-presenting cells...
93,43
P2286.9501 Nona arginine - Arg9 (R9) 
Cell penetrating peptide (CPPs) are characterised by their ability to promote the receptor-independent cellular uptake of membrane-impermeable...
116,00
P2781.0080 Omicron Variant B.1.1.529 Peptide Pool SARS-CoV-2 (Spike Glycoprotein) 
This peptide pool with 80 peptides covers all mutations in the Spike Glycoprotein derived from the omicron variant B.1.1.529 of SARS-CoV-2.
283,25
P2275.9501 Ova (257-264) SIINFEKL 
Ovalbumin (257-264) chicken has been used to trigger T cell activation in immunology studies.. T cell epitopes are presented on the surface of...
94,76
P3286.9505 Ova (257-264) SIINFEKL amide 
Ovalbumin (257-264) chicken has been used to trigger T cell activation in immunology studies.. T cell epitopes are presented on the surface of...
94,76
P2283.9501 Ova (323-339) ISQAVHAAHAEINEAGR 
T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically...
148,53
P3287.9505 Ova (323-339) ISQAVHAAHAEINEAGR - amide 
T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically...
111,24
P3288.9501 Ova (323-339) ISQAVHAAHAEINEAGR - amide 
T cell epitopes are presented on the surface of antigen-presenting cells by MHC molecules. T cell epitopes presented by MHC class I molecules are typically...
116,70
M3177.0250 Ovalbumin (crude) 
Albumin from chicken egg (Ovalbumin). Crude: min. 80% protein.
79,57
P3094.9505 p53 (264-272) HLA-A*0201 LLGRNSFEV 
108,75
P3093.9505 p53 (264-272) HLA-A*0201 LLGRNSFEV 
108,75
P2284.9501 PADRE - AKFVAAWTLKAAA 
pan HLA DR-binding epitope (PADRE) has been proposed as a simple carrier epitop. This mechanism ensures that cells infected by viruses or intracellular...
148,53
S5239.0100 Pancreatin 
Pancreatin is an complex enzymatic mixture of active ingredients that are obtained from the pancreas of domestic pigs.
49,97
S5240.0025 Papain from Carica papaya 
Papain is a member of the class of proteolytic enzymes that needs a free sulfhydryl group for activity (group of the cysteine proteases). The pH optimum of...
67,00
S5241.0025 Pepsin (EC 3.4.23.1) 
Pepsin from pig stomach. Its inactive precursor is the pepsinogen secreted by the main cells of the gastric mucosa. Pepsinogen is cleaved at acidic pH below...
53,79
P2262.7005 Peptide: NYSKMIFSHHHH 
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta...
163,46
P2273.9501 PLP (139-151) - HCLGKWLGHPDKF 
PLP (139 - 151) - HCLGKWLGHPDKF represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of...
160,68
P2274.9501 PLP (178-191) - NTWTTCQSIAFPSK 
PLP (178-191) - NTWTTCQSIAFPSK represents a short peptide sequence of the protein lipid part of the myelin sheath. Such proteins are obviously targets of the...
148,00
P3118.9505 PRAME (100-108) HLA-A*0201 VLDGLDVLL 
PRAME (100-108) HLA-A*0201 VLDGLDVLL for stimulation of human Prame (100-108) specific CD8+ T cells. The peptide is synthesised as it is presented by the MHC...
108,75
P3120.9505 PRAME (301-309) HLA-A24 LYVDSLFFL 
PRAME (100-108) HLA-A*0201 VLDGLDVLL for stimulation of human Prame (100-108) specific CD8+ T cells. The peptide is synthesised as it is presented by the MHC...
108,75
C6380.0001 rec. Human Serum Albumin (rHSA) 
Synonyms: Serum albumin, ALB, PRO0883, PRO0903, PRO1341, DKFZp779N1935, GIG20, GIG42, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696, SA, HSA.
583,50
M6380.0001 rec. Human Serum Albumin (rHSA) - from rice grain 
Synonyms: Serum albumin, ALB, PRO0883, PRO0903, PRO1341, DKFZp779N1935, GIG20, GIG42, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696, SA, HSA.
382,13
M6384.0010 rec. Human Serum Albumin (rHSA) - lipid-free 
Synonyms: Serum albumin, ALB, PRO0883, PRO0903, PRO1341, DKFZp779N1935, GIG20, GIG42, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696, SA, HSA.
249,31
S5197.0500 rec. L-Asparaginase 
L-Asparaginase. L-Asparaginase is an enzyme that depletes L-Asparagine an important nutrient for cancer cells resulting in cancer/tumor cell starvation....
201,96
S5344.0100 recombinant human ACE2 Protein (ECD), Avi/His-Tag, non-biotinylated 
reombinant human ACE2 Protein (ECD. processed) contains an Avi/His-Tag, and is ready for invitro biotinylation, We offer high purity. and quality in HEK293...
Peptides and Proteins 722,95
S5201.0001 recombinant Lysostaphin - EC 3.4.24.75 
Recombinant Lysostaphin. Synonyms: EC 3.4.24.75, Glycyl-glycine endopeptidase.
180,25
P3139.9505 RHAMM (165-173) HLA-A*0201 ILSLELMKL 
RHAMM peptide ILSLELMKL (HLA-A*0201) for stimulation of human RHAMM -specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I...
108,75
C6461.0010 rhCG - Corticotropin releasing hormone binding protein 
CRH is a powerful stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. CRH concentration in the human peripheral circulation is...
140,69
S5558.0100 rHu EpCAM - 100 µg 
Epithelial Cell Adhesion Molecule (EpCAM) also known as antigen GA733-2 is a 40 kDa transmembrane glycoprotein . It´s composed of a 242 aa extracellular...
525,00
S5557.0100 rHu HER2-ECD / ErbB2/Her2 
This protein family members (ErbB1-4) serve as receptors for epidermal growth factor. ErbB2 is found on the on the surface of epithelial cells and strongly...
618,33
S5553.0100 rHu Vitronectin 
Recombinant human vitronectin (rhnVN) from Genaxxon is a recombinant human protein that provides a defined surface for feeder-free culture of all sorts of...
246,49
C6499.0100 rhuPTH - recombinant human Parathyroid Hormon (aa 1-34) 
Parathyroid hormone (PTH), or parathormone, is secreted by the parathyroid glands as a polypeptide of 84 amino acids. It acts to increase the concentration...
318,80
P2257.7005 RIIGL - Inhibitor Peptide of amyloid-ß 
RIIGL is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the...
163,20
P3143.9505 RSV NP (137-145) HLA-A*02:01 KMLKEMGEV 
RSV NP (137-145) HLA-A*02:01 KMLKEMGEV is a linear peptidic epitope (epitope ID32357) studied as part of Nucleoprotein from Human respiratory syncytial...
108,75
P4000.9501 SARS-CoV SSp-1 A2 (HLA-A*02:01) - RLNEVAKNL 
RLNEVAKNL SARS-CoV SSp-1 A2 (HLA-A*02:01)
106,25
S5333.0100 SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilized Trimer 
The engineered recombinant Sars-Co-V-2 Spike S1 protein contains specific amino acid substitutions to stabilize the prefusion conformation (2P). Furthermore,...
Peptides and Proteins 588,16
S5348.0100 SARS-CoV-2 (COVID-19) Nucleocapsid protein - (1-419), His-Tag 
Beneath its envelope membrane, the new coronavirus SARS-CoV-2 consists of a icosaedric nucleocapsid that contains its genectic information in form of...
Peptides and Proteins 513,71
P4015.0102 SARS-CoV-2 (N-Protein) - Peptide Pool 
Peptide pool of 102 overlapping peptides of the Nucleoprotein of SARS-CoV-2. The peptide pools is derived from a peptide scan (15mers with 11 aa overlap -...
262,65
P4014.0316 SARS-CoV-2 (Spike Glycoprotein) Peptide Pool - 316 peptides 
SARS-CoV-2 (Spike Glycoprotein) Peptide Pool of 316 overlapping peptides (delivered in two subpools of 158 & 158 peptides) derived from a peptide scan...
592,25
S5347.0050 SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) 
SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.)...
Peptides and Proteins 250,64
S5346.0050 SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) 
SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (800-1000 a.a.)...
Peptides and Proteins 250,64
S5343.0050 SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic - with His-Tag 
SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and...
Peptides and Proteins 250,64
S5341.0050 SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag...
Peptides and Proteins 1108,38
P4005.9501 SARS-CoV-2 Membrane GP A2 (61-70) TLACFVLAAV 
SARS-CoV-2 Membrane GP A2 TLACFVLAAV with amino acids 61-70 of the Membrane GP A2 protein is an antigen-specific SARS-CoV-2 peptide.
106,25
S5342.0050 SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc...
Peptides and Proteins 1108,38
P4007.9501 SARS-CoV-2 Nucleocapsid _1 B7 FPRGQGVPI 
SARS-CoV-2 Nucleocapsid _1 B7 FPRGQGVPI is an antigen-specific SARS-CoV-2 peptide.
106,25
P4008.9501 SARS-CoV-2 Nucleocapsid _2 B7 SPRWYFYYL 
SARS-CoV-2 Nucleocapsid _2 B7 SPRWYFYYL is an antigen-specific SARS-CoV-2 peptide.
106,25
P4009.9501 SARS-CoV-2 Nucleocapsid _3 B7 KPRQKRTAT 
SARS-CoV-2 Nucleocapsid _3 B7 KPRQKRTAT is an antigen-specific SARS-CoV-2 peptide.
106,25
P4001.9501 SARS-CoV-2 Nucleocapsid A2 (138-146) - ALNTPKDHI 
SARS-CoV-2 Nucleocapsid A2 peptide with amino acids 138-146 (ALNTPKDHI)
106,25
P4003.9501 SARS-CoV-2 Nucleocapsid A2 (219-227) LQLPQGTTL 
SARS-CoV-2 Nucleocapsid A2 peptide LQLPQGTTL with amino acids 219-227 of the Nucleocapsid protein is an antigen-specific SARS-CoV-2 peptide.
106,25
P4004.9501 SARS-CoV-2 Nucleocapsid A2 (226-234) LALLLLDRL 
SARS-CoV-2 Nucleocapsid A2 peptide with amino acids 226-234 (LALLLLDRL)
106,25
P4002.9501 SARS-CoV-2 Nucleocapsid A2 (316-324) GMSRIGMEV 
SARS-CoV-2 Nucleocapsid A2 peptide GMSRIGMEV with amino acids 316-324 is an antigen-specific SARS-CoV-2 peptide.
106,25
P4006.9501 SARS-CoV-2 Nucleocapsid A2 (N223-231) LLLDRLNQL 
SARS-CoV-2 Nucleocapsid A2 peptide with amino acids N223-231 (LLLDRLNQL)
106,25
S5334.0100 SARS-CoV-2 Spike S1 Protein (RBD) - without Tag 
SARS-CoV-2 Spike Protein RBD Recombinant without His-tag is a recombinant protein that is in liquid form buffered in PBS. This protein was produced...
Peptides and Proteins 304,62
S5340.0100 SARS-CoV-2 Spike S1 Protein (RBD) with His-Tag 
SARS-CoV-2 Spike Protein RBD Recombinant with C-terminal His-tag is a recombinant protein that is in liquid form buffered in PBS. This protein was produced...
Peptides and Proteins 384,31
P4010.9501 SARS-CoV-2 Surface GP A2 (1000-1008) - YLQPRTFLL 
SARS-CoV-2 Surface A2 peptide with amino acids YLQPRTFLL
131,25
P4011.9501 SARS-CoV-2 Surface GP_1 A1 (865-873) - LTDEMIAQY 
SARS-CoV-2 Nucleocapsid A1 peptide with amino acids LTDEMIAQY
106,25
P4012.9501 SARS-CoV-2 Surface GP_1 A3 (378-386) - KCYGVSPTK 
SARS-CoV-2 Nucleocapsid A3 peptide with amino acids KCYGVSPTK
285,00
P3144.9505 SART3 (309-317) HLA-A*02:01 RLAEYQAYI 
108,75
S5367.1100 Serratia Nuclease - 100000 IU 
Serratia nuclease is a non-specific enzyme that cleaves all forms of DNA and RNA very efficiently. It is commonly used on biological material for the...
656,84
S5366.1000 TEV Protease from Tobacco Etch Virus - min. 95% pure 
TEV-protease is a highly site-specific cysteine protease that is found in the Tobacco Etch Virus (TEV). The Genaxon TEV protease comes with an N-terminal...
179,93
M6077.0005 Trypsin from bovine pancreas 
Trypsin from bovine pancreas, Tryptic activity (BAEE): min. 2500 U/mg. Lyophilised. No P. aeruginosa, Salmonella, Staphyloccus aureus detectable. Synonym:...
358,00
C4264.0025 Trypsin powder from porcine pancreas (1:250) 
The native form of Trypsin consists of a single chain polypeptide of 223 amino acid residues, produced by the removal of the N-terminal hexapeptide from...
128,87
P3175.9505 Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV 
Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV for stimulation of T-cells. The single peptide (YMDGTMSQV) is used for stimulation of human gp100-specific...
108,75
P3176.9505 Tyrosinase (425-434) HLA-A*03:01 YMVPFIPLYR 
Tyrosinase (369-377) (371D) HLA-A*02:01 YMDGTMSQV for stimulation of T-cells. The single peptide (YMDGTMSQV) is used for stimulation of human gp100-specific...
108,75
P4016.0025 Variant B.1.617.1 (Kappa ) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) 
Peptide pool with 25 peptides covers all mutations in the Spike Glycoprotein derived from the kappa variant B.1.617.1 of SARS-CoV-2 which emerged in India in...
262,65
P4013.0027 Variant B.1.617.2 (Delta) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) 
The Variant B.1.617.2 (Delta) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) with 27 peptides covers all mutations in the Spike Glycoprotein derived from the...
262,65
P2784.0315 Variant Omicron B.1.1.529 BA.5 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein) 
This peptide pool of the omicron variant B.1.1.529 BA.5 of SARS-CoV-2 (315 peptides, delivered in two subpools of 158 & 157 peptides) that covers the whole...
836,58
P2780.0315 Variant Omicron B.1.1.529 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein) 
This peptide pool of the new omicron variant of SARS-CoV-2 (315 peptides, delivered in two subpools of 158 & 157 peptides) that covers the whole spike...
836,58
C4366.0500 Zymolyase(R) -100T 
Zymolyase®, produced by a submerged culture of Arthrobacter luteus, has strong lytic activity against living yeast cell walls to produce protoplast or...
802,15
C4352.0001 Zymolyase(R) -20T 
Zymolyase®, produced by a submerged culture of Arthrobacter luteus, has strong lytic activity against living yeast cell walls to produce protoplast or...
297,41
P2305.9501 α-Defensin 5 human - ATCYCRTGRCATRESLSGVCEISGRLYRLCCR 
α-Defensin 5 (peptide sequence: ATCYCRTGRCATRESLSGVCEISGRLYRLCCR) belongs to a group of antimicrobial active peptides (antimicrobial peptides = AMPs), with a...
720,00
1