Advantages at a glance
- Pool of 102 peptides of Covid-19 N-Protein
- Quantity: approx. 25µg per peptide (2.6mg in total)
- Content of one tube sufficient for the stimulation of 2.5 x 10E8 cells.
- Free shipping
- Shipping within 24h
- 30 days money back guarantee
- Purchase comfortable on account
Product information "SARS-CoV-2 (N-Protein) - Peptide Pool"
Peptide pool of 102 overlapping peptides of the Nucleoprotein of SARS-CoV-2. The peptide pools is derived from a peptide scan (15mers with 11 aa overlap - UniProt: P0DTC9) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays (e.g. ELISPOT).
The content of one tube is sufficient for the stimulation of 2.5 x 10E8 cells.
Length: 419 amino acids - peptide scan 15/11
Sequence:
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKD
GIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASK
KPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQ
RQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
Specifications:
Pool of 102 peptides of Covid-19 N-Protein
Quantity: approx. 25µg per peptide (2.6mg in total)
Peptides supplied as trifluoro acetate salts
Quality check: by ESI-MS
Protein ID: P0DTC9 (swiss prot)
Application:
T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune responseSource:
syntheticClassification:
Documents:
Dissolve in a minimum amount of pure DMSO (approx. 40μL) and dilute with water to the desired concentration. Please pay attention that the final concentration of DMSO must be below 1% (v/v) to avoid toxicity in the biological assay.